DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and LRFN5

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001333102.1 Gene:LRFN5 / 145581 HGNCID:20360 Length:719 Species:Homo sapiens


Alignment Length:470 Identity:116/470 - (24%)
Similarity:185/470 - (39%) Gaps:130/470 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IDSKLC-KKCNCYI-DTNLLD-CSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVPILPKY 103
            :.:::| |:|.|.| ..||.. |::|                .::|...|::...:         
Human    15 VKAQICPKRCVCQILSPNLATLCAKK----------------GLLFVPPNIDRRTV--------- 54

  Fly   104 DVENLYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLN 168
               .|.||:|.:.:|....|.|:|.||.|.||.|.::.           .|...|..|.||:.|:
Human    55 ---ELRLADNFVTNIKRKDFANMTSLVDLTLSRNTISF-----------ITPHAFADLRNLRALH 105

  Fly   169 LGYNDLHSLDADLFEHIPHIEELVLCSNSFHVIDQLSETAISGLQSLKILDVSYMEIDDLP-DTI 232
            |..|.|..:..|:|..:.::..|:|.:|...:|   |.||...:.:|:.||:||..::.:| |  
Human   106 LNSNRLTKITNDMFSGLSNLHHLILNNNQLTLI---SSTAFDDVFALEELDLSYNNLETIPWD-- 165

  Fly   233 LHGPRDLEIFIAAGNLFNQLPKALKYATNLTSLVLNENPIENLIGDNVFPPLTKLTHLSMTFMSK 297
                                  |::...:|.:|.|:.|.|:| |....|..|.|:|.|.:| .:|
Human   166 ----------------------AVEKMVSLHTLSLDHNMIDN-IPKGTFSHLHKMTRLDVT-SNK 206

  Fly   298 LYKIGPG-AFSELQSL-TELILSDNKLLNEIDEEALSKNVTGGQYLDYPPLEKVYLNNCNVSTLP 360
            |.|:.|. .|...|.| |..|:|.:..       |||   .||.     ||      :||...|.
Human   207 LQKLPPDPLFQRAQVLATSGIISPSTF-------ALS---FGGN-----PL------HCNCELLW 250

  Fly   361 KELLVRWDKLKA------LDLRFNPWNCDESNDFLINVLIDRINKTTPVL---AKDVKC---GGP 413
            ...|.|.|.|:.      |..|:. |:..|........||.|......||   ...::|   |.|
Human   251 LRRLSREDDLETCASPPLLTGRYF-WSIPEEEFLCEPPLITRHTHEMRVLEGQRATLRCKARGDP 314

  Fly   414 NKLNDVTLLRVANE-HMIESSTGSLIW-VGLLVVLLIAVPTIIGAYVMKRRGCFGVFRRHDSGAS 476
                :..:..::.| .:|.::|.||:: .|.|.:|:..|         |..|.|.....:.:|.:
Human   315 ----EPAIHWISPEGKLISNATRSLVYDNGTLDILITTV---------KDTGAFTCIASNPAGEA 366

  Fly   477 SALYNRTSFNEDFHI 491
            :.:.       |.||
Human   367 TQIV-------DLHI 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 81/317 (26%)
leucine-rich repeat 85..104 CDD:275380 1/18 (6%)
LRR_8 105..174 CDD:290566 22/68 (32%)
leucine-rich repeat 105..128 CDD:275380 7/22 (32%)
leucine-rich repeat 129..163 CDD:275380 9/33 (27%)
LRR_8 163..222 CDD:290566 18/58 (31%)
leucine-rich repeat 164..187 CDD:275380 7/22 (32%)
leucine-rich repeat 188..214 CDD:275380 7/25 (28%)
leucine-rich repeat 215..238 CDD:275380 7/23 (30%)
leucine-rich repeat 239..261 CDD:275380 1/21 (5%)
LRR_8 260..322 CDD:290566 23/63 (37%)
leucine-rich repeat 262..286 CDD:275380 9/23 (39%)
leucine-rich repeat 287..311 CDD:275380 8/24 (33%)
leucine-rich repeat 346..369 CDD:275380 6/22 (27%)
leucine-rich repeat 370..388 CDD:275380 5/23 (22%)
LRFN5NP_001333102.1 LRR 1 52..73 6/32 (19%)
LRR 2 76..97 8/31 (26%)
LRR 3 100..121 8/20 (40%)
LRR 4 124..145 7/23 (30%)
LRR 5 148..169 8/44 (18%)
LRR 6 172..193 8/21 (38%)
LRR 7 196..217 8/21 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..414
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 615..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.