DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and LRRC38

DIOPT Version :10

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001010847.1 Gene:LRRC38 / 126755 HGNCID:27005 Length:294 Species:Homo sapiens


Alignment Length:235 Identity:56/235 - (23%)
Similarity:103/235 - (43%) Gaps:18/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 IDDLPDTILHGPRDLEIFIAAGNLFNQLPK-ALKYATNLTSLVLNENPIENLIGDNVFPPLTKLT 288
            :..:||..   |.|:...:.|||...::|: ...:..:|..|....|.:.:| .:..|....||.
Human    47 LPSVPDPF---PLDVRKLLVAGNRIQRIPEDFFIFYGDLVYLDFRNNSLRSL-EEGTFSGSAKLV 107

  Fly   289 HLSMTFMSKLYKIGPGAFSELQSLTELILSDNKLLNEIDEEALSKNVTGGQYLDYPPLEKVYLNN 353
            .|.::: :.|.::|.|||.....|.:|.|::|.|:. :.|:|         :.....|:.:.||:
Human   108 FLDLSY-NNLTQLGAGAFRSAGRLVKLSLANNNLVG-VHEDA---------FETLESLQVLELND 161

  Fly   354 CNVSTLPKELLVRWDKLKALDLRFNPWNCDESNDFLINVLIDRINKTTPVLAKDVKCGGPNKLND 418
            .|:.:|....|.....|::|.|..|||.||.....|.:.:.:..:| .|....:::|..|.:...
Human   162 NNLRSLSVAALAALPALRSLRLDGNPWLCDCDFAHLFSWIQENASK-LPKGLDEIQCSLPMESRR 225

  Fly   419 VTLLRVANEHMIESSTGSLIWVGLLVVLLIAVPTIIGAYV 458
            :: ||..:|........||....|.:::...|...|.|.:
Human   226 IS-LRELSEASFSECRFSLSLTDLCIIIFSGVAVSIAAII 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR 54..>322 CDD:443914 25/97 (26%)
leucine-rich repeat 85..104 CDD:275380
leucine-rich repeat 105..128 CDD:275380
leucine-rich repeat 129..163 CDD:275380
leucine-rich repeat 164..187 CDD:275380
leucine-rich repeat 188..214 CDD:275380
leucine-rich repeat 215..238 CDD:275380 3/12 (25%)
leucine-rich repeat 239..261 CDD:275380 4/22 (18%)
leucine-rich repeat 262..286 CDD:275380 5/23 (22%)
leucine-rich repeat 287..311 CDD:275380 7/23 (30%)
leucine-rich repeat 346..369 CDD:275380 6/22 (27%)
leucine-rich repeat 370..388 CDD:275380 8/17 (47%)
LRRC38NP_001010847.1 LRRNT 27..58 CDD:214470 3/13 (23%)
leucine-rich repeat 38..56 CDD:275380 2/11 (18%)
LRR 1 57..78 5/20 (25%)
LRR_8 58..116 CDD:404697 12/59 (20%)
leucine-rich repeat 58..81 CDD:275378 4/22 (18%)
LRR 2 81..102 5/21 (24%)
leucine-rich repeat 82..105 CDD:275378 5/23 (22%)
LRR 3 105..126 8/21 (38%)
leucine-rich repeat 106..129 CDD:275378 7/23 (30%)
LRR_8 109..164 CDD:404697 16/65 (25%)
LRR 4 129..150 7/30 (23%)
leucine-rich repeat 130..153 CDD:275378 7/32 (22%)
LRR 5 153..174 6/20 (30%)
leucine-rich repeat 154..165 CDD:275378 4/10 (40%)
leucine-rich repeat 178..197 CDD:275380 8/18 (44%)
LRRCT 186..237 CDD:214507 13/52 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.