DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and CHAD

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_011522516.1 Gene:CHAD / 1101 HGNCID:1909 Length:440 Species:Homo sapiens


Alignment Length:363 Identity:81/363 - (22%)
Similarity:133/363 - (36%) Gaps:111/363 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KKCNCYIDTNLLDC-----------SEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVPILP 101
            :.|:|:.|...:.|           |||.                   |.:||:.||.   |:|.
Human   106 QNCHCHSDLQHVICDKVGLQKIPKVSEKT-------------------KLLNLQRNNF---PVLA 148

  Fly   102 KY------DVENLYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFES 160
            ..      ::.:|:|.:.||..::.|||:.|.:|:.|.|||                        
Human   149 ANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSH------------------------ 189

  Fly   161 LENLKTLNLGYNDLHSLDADLFEHIPHIEELVLCSNSFHVIDQLSETAISGLQSLKILDVSYMEI 225
                       ||:..|.|..|:.:..:..|.|..|.   :.:|....:|.|.:|.||.::..:|
Human   190 -----------NDIRVLRAGAFDDLTELTYLYLDHNK---VTELPRGLLSPLVNLFILQLNNNKI 240

  Fly   226 DDLPDTILHGPRDLE-IFIAAGNLFNQLPKALKYATNLTSLVLNENPIENLIGDNVFPPLT---- 285
            .:|......|.:||. ::::...|.:..|.||....||....::.|.:.:      :|...    
Human   241 RELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSS------YPSAALSKL 299

  Fly   286 ------KLTHLSMTFMSKLYKIGPGAFSELQSLTELILSDNKLLNEIDEEALSKNVTGGQYLDYP 344
                  ||:|      :.|..|...||.......|.:..||..|.:..:         |.:|...
Human   300 RVVEELKLSH------NPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSD---------GAFLGVT 349

  Fly   345 PLEKVYLNNCNVSTLPKELLVRWDKLKALDLRFNPWNC 382
            .|:.|:|.|..::.||...  .:|.|:.|.|..|||.|
Human   350 TLKHVHLENNRLNQLPSNF--PFDSLETLALTNNPWKC 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 70/325 (22%)
leucine-rich repeat 85..104 CDD:275380 7/24 (29%)
LRR_8 105..174 CDD:290566 14/68 (21%)
leucine-rich repeat 105..128 CDD:275380 8/22 (36%)
leucine-rich repeat 129..163 CDD:275380 5/33 (15%)
LRR_8 163..222 CDD:290566 14/58 (24%)
leucine-rich repeat 164..187 CDD:275380 5/22 (23%)
leucine-rich repeat 188..214 CDD:275380 6/25 (24%)
leucine-rich repeat 215..238 CDD:275380 6/22 (27%)
leucine-rich repeat 239..261 CDD:275380 5/22 (23%)
LRR_8 260..322 CDD:290566 14/71 (20%)
leucine-rich repeat 262..286 CDD:275380 3/33 (9%)
leucine-rich repeat 287..311 CDD:275380 6/23 (26%)
leucine-rich repeat 346..369 CDD:275380 6/22 (27%)
leucine-rich repeat 370..388 CDD:275380 7/13 (54%)
CHADXP_011522516.1 LRRNT 104..130 CDD:279764 4/23 (17%)
leucine-rich repeat 134..157 CDD:275380 7/44 (16%)
LRR_8 156..216 CDD:290566 21/97 (22%)
leucine-rich repeat 158..181 CDD:275380 8/22 (36%)
LRR_RI <171..363 CDD:238064 53/250 (21%)
leucine-rich repeat 182..205 CDD:275380 10/57 (18%)
LRR_8 204..264 CDD:290566 14/62 (23%)
leucine-rich repeat 206..229 CDD:275380 6/25 (24%)
leucine-rich repeat 230..253 CDD:275380 6/22 (27%)
leucine-rich repeat 254..277 CDD:275380 5/22 (23%)
leucine-rich repeat 278..301 CDD:275380 3/28 (11%)
LRR_8 302..361 CDD:290566 17/73 (23%)
leucine-rich repeat 302..325 CDD:275380 7/28 (25%)
leucine-rich repeat 327..350 CDD:275380 6/31 (19%)
leucine-rich repeat 351..373 CDD:275380 7/23 (30%)
LRRCT 381..428 CDD:214507 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D334557at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.