DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and lrrc15

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_031758235.1 Gene:lrrc15 / 100496322 XenbaseID:XB-GENE-990725 Length:588 Species:Xenopus tropicalis


Alignment Length:394 Identity:108/394 - (27%)
Similarity:180/394 - (45%) Gaps:58/394 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSV-PIL--PKYDVENLYLANNQIDSISVGAF 123
            :.|||: |....::||..    .:|:.|.:|.:..: |.|  ...:|::|.:..|.::||.||||
 Frog   108 NNKLQE-LHGNLFKDLAK----LETLILSNNQINQIHPSLFTALSNVKDLQMVGNNLESIPVGAF 167

  Fly   124 QNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLNLGYNDLHSLDADLFEHIPHI 188
            ..::.|:.|:|:.|.:  |.|.|         |.|:.|..|:||.|..|.|..:.|...:.:..:
 Frog   168 DQMSGLLKLNLAKNSI--KYLPP---------QAFDKLAKLQTLRLYENQLQDIPAGFLKKLSSL 221

  Fly   189 EELVLCSNSFHVIDQLSETAISGLQSLKILDVSYMEIDDLPDTILHGPRDLEIFIAAGN------ 247
            :|:.|.||.   :.:||....||...|:.:.:|..|||.||..|.....::......||      
 Frog   222 QEVALHSNK---LIELSTDTFSGNPYLQKVFLSNNEIDSLPRGIFLNLPEITKLTLYGNALRELT 283

  Fly   248 --LFNQLPKALKYATNLTSLVLNENPIENLIGDNVFPPLTKLTHLSMTFMSKLYKIGPGAFSELQ 310
              :|..:||       |..|.|.:|.:|.|. ||||..||: |.|.:...:|:..|...||..|:
 Frog   284 TGVFGPMPK-------LKELWLYDNQLEQLT-DNVFSNLTE-TVLLVISKNKIRSISTHAFCGLE 339

  Fly   311 SLTELILSDNKLLNEIDEEALS-----KNVT----------GGQYLDYPPLEKVYLNNCNVSTLP 360
            .|.||.|..| ||..:|::.|.     :|::          |..:.:...:..:.|.|.::..:|
 Frog   340 ELQELSLHTN-LLTTLDQDVLKCLPKLQNISLHSNKIQYLPGDLFKNMDTVMNIQLQNNSLEDIP 403

  Fly   361 KELLVRWDKLKALDLRFNPWNCDESNDFLINVLIDRINKTTPVLAKDVKCGGPNKLNDVTLLRVA 425
            .:......:|..:.|..|||.||.:...|.|.|.:.:||... |::.|....|  .|.:.:..::
 Frog   404 HDFFDSLVQLNEVKLYENPWKCDHNLLSLKNWLSENMNKLGN-LSQLVCTNSP--FNGIPISELS 465

  Fly   426 NEHM 429
            :|.:
 Frog   466 DEQL 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 90/334 (27%)
leucine-rich repeat 85..104 CDD:275380 5/21 (24%)
LRR_8 105..174 CDD:290566 24/68 (35%)
leucine-rich repeat 105..128 CDD:275380 9/22 (41%)
leucine-rich repeat 129..163 CDD:275380 10/33 (30%)
LRR_8 163..222 CDD:290566 16/58 (28%)
leucine-rich repeat 164..187 CDD:275380 7/22 (32%)
leucine-rich repeat 188..214 CDD:275380 8/25 (32%)
leucine-rich repeat 215..238 CDD:275380 8/22 (36%)
leucine-rich repeat 239..261 CDD:275380 5/29 (17%)
LRR_8 260..322 CDD:290566 24/61 (39%)
leucine-rich repeat 262..286 CDD:275380 11/23 (48%)
leucine-rich repeat 287..311 CDD:275380 7/23 (30%)
leucine-rich repeat 346..369 CDD:275380 3/22 (14%)
leucine-rich repeat 370..388 CDD:275380 7/17 (41%)
lrrc15XP_031758235.1 leucine-rich repeat 35..51 CDD:275380
LRR_8 51..111 CDD:404697 0/2 (0%)
leucine-rich repeat 54..76 CDD:275380
leucine-rich repeat 77..100 CDD:275380
internalin_A 98..>449 CDD:380193 104/370 (28%)
leucine-rich repeat 101..124 CDD:275380 6/16 (38%)
leucine-rich repeat 125..148 CDD:275380 5/22 (23%)
leucine-rich repeat 149..172 CDD:275380 9/22 (41%)
leucine-rich repeat 173..196 CDD:275380 10/33 (30%)
leucine-rich repeat 197..220 CDD:275380 7/22 (32%)
leucine-rich repeat 221..244 CDD:275380 8/25 (32%)
leucine-rich repeat 245..268 CDD:275380 8/22 (36%)
leucine-rich repeat 269..292 CDD:275380 3/22 (14%)
leucine-rich repeat 293..316 CDD:275380 11/23 (48%)
leucine-rich repeat 317..340 CDD:275380 7/22 (32%)
leucine-rich repeat 341..362 CDD:275380 9/21 (43%)
leucine-rich repeat 365..388 CDD:275380 2/22 (9%)
leucine-rich repeat 389..410 CDD:275380 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.