DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and si:dkey-182i3.11

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_021322095.1 Gene:si:dkey-182i3.11 / 100334238 ZFINID:ZDB-GENE-121214-258 Length:710 Species:Danio rerio


Alignment Length:482 Identity:121/482 - (25%)
Similarity:202/482 - (41%) Gaps:140/482 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IDTNLLD-CSEKLQDWLSAEDWEDLTNGN-----------------------VVFKTIN-----L 89
            |:.|:.: |:...:.:||....:.:.||:                       |:.:|.|     |
Zfish   214 IEMNVFENCTYLAKLYLSKNKLKSVGNGSFKGATGLNHLDLGLNGLAGIPTIVLQETSNLTSLYL 278

  Fly    90 EHNNLTSVP------ILPKYDVENLYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDV 148
            :.|::||:|      ||   .:::|.|:.|.:.|||.|:|::|::||.||||.|:|.:       
Zfish   279 QKNDITSIPDNVFSEIL---SLKHLDLSYNGLVSISNGSFRSLSQLVYLDLSFNQLQT------- 333

  Fly   149 FKGPFTVQDFESLENLKTLNLGYNDLHSLDADLFEHIPHIEELVLCSNSFHVID----------- 202
                .|...||.|..|:.|||.:|.|.||..::|:::..::||.|.||:..||.           
Zfish   334 ----LTQHVFEDLGKLENLNLYHNKLTSLPNNMFKNLTMLKELQLDSNNISVIPPDLFHPLSALK 394

  Fly   203 --QLSETAISGLQS--------LKILDVSYMEIDDLPDTILH-GPRDLEI------FIAA----- 245
              ||....||.|.|        ||.||:|..::..:|:.:.| ..::|.:      ||:.     
Zfish   395 DLQLDNNHISKLHSHTFKKLRQLKQLDISSNDLTKIPNHLFHKNLKELNLENNHISFISKFSFKN 459

  Fly   246 -----------GNLFNQLPKALKYATNLTSLVLNENPIENL-----------------------I 276
                       .||.....:.|...|.|..|:||||.||.:                       |
Zfish   460 LHRLQSLKLSHNNLSKLYRELLTNLTRLRELLLNENQIETIPVGFFKGLENLRVLDLSNNKMHFI 524

  Fly   277 GDNVFPPLTKLTHLSMTFMSKLYKIGPGAFSELQSLTELILSDNKL----------LNEIDEEAL 331
            ..:.|..|:.|..|.::| :.|:.:....|:.|::||:|.|.:|||          |..::|..|
Zfish   525 LPDAFNDLSALKDLDLSF-NFLHNLPEDIFASLRNLTKLHLQNNKLRYLPSRLFSALVGLEELHL 588

  Fly   332 SKN----VTGGQYLDYPPLEKVYLNNCNVSTLPKELLVRWDKLKALDLRFNPWNCDE------SN 386
            .:|    :...|:.....|.::.:.:..:.::....|:...|||.:.|..|||:|..      |.
Zfish   589 DRNYIQRIHPTQFEGLVKLHELDMKSNQLRSMEDGTLMPLRKLKRIHLDGNPWDCSTVVILYISQ 653

  Fly   387 DFLINVLIDRINKTTPVLAKDVKCGGP 413
            .|..|.   ::.||||:.:.......|
Zfish   654 WFNNNT---QLVKTTPMCSSGQNLSNP 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 106/423 (25%)
leucine-rich repeat 85..104 CDD:275380 9/29 (31%)
LRR_8 105..174 CDD:290566 26/68 (38%)
leucine-rich repeat 105..128 CDD:275380 9/22 (41%)
leucine-rich repeat 129..163 CDD:275380 12/33 (36%)
LRR_8 163..222 CDD:290566 26/79 (33%)
leucine-rich repeat 164..187 CDD:275380 9/22 (41%)
leucine-rich repeat 188..214 CDD:275380 12/38 (32%)
leucine-rich repeat 215..238 CDD:275380 7/23 (30%)
leucine-rich repeat 239..261 CDD:275380 6/43 (14%)
LRR_8 260..322 CDD:290566 23/84 (27%)
leucine-rich repeat 262..286 CDD:275380 11/46 (24%)
leucine-rich repeat 287..311 CDD:275380 6/23 (26%)
leucine-rich repeat 346..369 CDD:275380 2/22 (9%)
leucine-rich repeat 370..388 CDD:275380 8/23 (35%)
si:dkey-182i3.11XP_021322095.1 PLN00113 97..>617 CDD:331614 104/417 (25%)
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..176 CDD:275380
leucine-rich repeat 177..200 CDD:275380
leucine-rich repeat 201..224 CDD:275380 3/9 (33%)
leucine-rich repeat 225..248 CDD:275380 4/22 (18%)
leucine-rich repeat 249..272 CDD:275380 2/22 (9%)
leucine-rich repeat 273..296 CDD:275380 7/25 (28%)
leucine-rich repeat 297..320 CDD:275380 9/22 (41%)
leucine-rich repeat 321..344 CDD:275380 12/33 (36%)
leucine-rich repeat 345..368 CDD:275380 9/22 (41%)
leucine-rich repeat 369..392 CDD:275380 7/22 (32%)
leucine-rich repeat 393..438 CDD:275380 13/44 (30%)
leucine-rich repeat 417..436 CDD:275380 6/18 (33%)
leucine-rich repeat 439..462 CDD:275380 3/22 (14%)
leucine-rich repeat 463..486 CDD:275380 3/22 (14%)
leucine-rich repeat 487..510 CDD:275380 8/22 (36%)
leucine-rich repeat 511..534 CDD:275380 3/22 (14%)
leucine-rich repeat 535..558 CDD:275380 6/23 (26%)
leucine-rich repeat 559..582 CDD:275380 8/22 (36%)
leucine-rich repeat 583..606 CDD:275380 4/22 (18%)
leucine-rich repeat 607..628 CDD:275380 2/20 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.