DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and si:ch211-180f4.1

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001373634.1 Gene:si:ch211-180f4.1 / 100144405 ZFINID:ZDB-GENE-080327-27 Length:744 Species:Danio rerio


Alignment Length:473 Identity:115/473 - (24%)
Similarity:192/473 - (40%) Gaps:98/473 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTKSATLAAAIFCIVLSQVSGQTKDETTTTETPK---EKIKVIDSKLCKKC-------NCYIDT- 56
            ||....||.....:.:.....|...||....||:   .:.|.:|   |.:.       |..:|| 
Zfish    11 LTVCLVLAVCRCSLAVPFCPAQCVCETRPWYTPQSVYHQAKTVD---CNELHLSRIPWNISVDTQ 72

  Fly    57 -------NLLDCSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVPILPKYDVENLYLANNQ 114
                   |:...:.:||..::..:.:...|.......:.|  ||||        .:..|||..||
Zfish    73 VLLLQSNNISRGTSQLQSLVNLTELDLSQNHFTQIHDVGL--NNLT--------QLVTLYLEENQ 127

  Fly   115 IDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLNLGYNDLHSLDA 179
            |..:.....::|..|..|.::||:::|  :.|:.|.|         |.||..|:|..|.|.::|:
Zfish   128 IKELPDMCLKDLVSLEELYINHNQISS--IGPNAFSG---------LGNLLRLHLNSNKLVAIDS 181

  Fly   180 DLFEHIPHIEELVLCSN--------SFHVIDQLSETAISGLQSLKILDVSYMEIDDLPDTILHGP 236
            ..||.:|::|.|::..|        :||.:.:|....::|           |.:.::|:....|.
Zfish   182 HWFESLPNLEILMIGENPILGLQDMNFHPLTKLHSLVLAG-----------MGLREIPEGAFQGL 235

  Fly   237 RDLEIFIAAGNLFNQLP-KALKYATNLTSLVLNENPIENLIGDNVFPPLTKLTHLSMTFMSKLYK 300
            ..||......|....:| |||:...:|..|.||:|||.. |.:..|.....|..||:..|.:|..
Zfish   236 EYLESLSFFDNKLTAVPKKALRVLPSLKFLDLNKNPIVR-IQEGDFQDFPHLEELSLNNMEELVA 299

  Fly   301 IGPGAFSELQSLTELILSDNKLLNEIDEEALSKNVTGGQYLDYPPLEKVYLNNCNVSTLPKELLV 365
            :..|:||.|..:.:|.|.:|..|..||..|         :|....|..:.::|.:::.||.|::.
Zfish   300 VERGSFSNLPQMAKLELYNNPHLFFIDRAA---------FLKMRGLRTLLIHNNDLTLLPHEIVS 355

  Fly   366 RWDKLKALDLRFNPWNCDESNDFLINVLIDRINKTTPVLAKDVKCGGPNKLN----DVTLLRVAN 426
            .:..|..:.|..||..|            |.:|...|||      |..:.|.    .:||. .:.
Zfish   356 AFPNLDEISLHSNPLRC------------DCLNNWGPVL------GNQSSLKVLEPQITLC-ASP 401

  Fly   427 EHMIESSTGSLI---WVG 441
            :|::..:...::   |.|
Zfish   402 QHLVGQALQDVVSASWNG 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 82/317 (26%)
leucine-rich repeat 85..104 CDD:275380 5/18 (28%)
LRR_8 105..174 CDD:290566 21/68 (31%)
leucine-rich repeat 105..128 CDD:275380 7/22 (32%)
leucine-rich repeat 129..163 CDD:275380 9/33 (27%)
LRR_8 163..222 CDD:290566 17/66 (26%)
leucine-rich repeat 164..187 CDD:275380 8/22 (36%)
leucine-rich repeat 188..214 CDD:275380 7/33 (21%)
leucine-rich repeat 215..238 CDD:275380 3/22 (14%)
leucine-rich repeat 239..261 CDD:275380 7/22 (32%)
LRR_8 260..322 CDD:290566 21/61 (34%)
leucine-rich repeat 262..286 CDD:275380 9/23 (39%)
leucine-rich repeat 287..311 CDD:275380 9/23 (39%)
leucine-rich repeat 346..369 CDD:275380 5/22 (23%)
leucine-rich repeat 370..388 CDD:275380 5/17 (29%)
si:ch211-180f4.1NP_001373634.1 leucine-rich repeat 51..70 CDD:275380 4/21 (19%)
PPP1R42 55..266 CDD:411060 57/242 (24%)
leucine-rich repeat 71..93 CDD:275380 4/21 (19%)
leucine-rich repeat 94..117 CDD:275380 6/32 (19%)
leucine-rich repeat 118..141 CDD:275380 7/22 (32%)
leucine-rich repeat 142..165 CDD:275380 9/33 (27%)
leucine-rich repeat 166..189 CDD:275380 8/22 (36%)
leucine-rich repeat 190..213 CDD:275380 5/22 (23%)
leucine-rich repeat 214..237 CDD:275380 5/33 (15%)
leucine-rich repeat 238..261 CDD:275380 7/22 (32%)
LRR_8 260..320 CDD:404697 20/60 (33%)
leucine-rich repeat 262..285 CDD:275380 9/23 (39%)
leucine-rich repeat 286..310 CDD:275380 9/23 (39%)
leucine-rich repeat 311..330 CDD:275380 7/27 (26%)
leucine-rich repeat 336..359 CDD:275378 5/22 (23%)
PCC 341..>412 CDD:188093 19/89 (21%)
leucine-rich repeat 360..372 CDD:275378 4/11 (36%)
IG 434..528 CDD:214652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.