DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and CD86

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_787058.5 Gene:CD86 / 942 HGNCID:1705 Length:329 Species:Homo sapiens


Alignment Length:180 Identity:41/180 - (22%)
Similarity:70/180 - (38%) Gaps:38/180 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEPKRWHLHLSCFLLLLSSTFSDVGKITSSQNHFGNT--LQSQFNTKNNTRVIAQKGGLAILPCV 63
            |:| :..:.||..|.:::...|....: ..|.:|..|  |..||....|..:             
Human     1 MDP-QCTMGLSNILFVMAFLLSGAAPL-KIQAYFNETADLPCQFANSQNQSL------------- 50

  Fly    64 VKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGH-------WSLRIKAVREEDRGF 121
                |...|.|..:::..|..|.|.....|.    .|:::||.       |:||:..::.:|:|.
Human    51 ----SELVVFWQDQENLVLNEVYLGKEKFDS----VHSKYMGRTSFDSDSWTLRLHNLQIKDKGL 107

  Fly   122 YECQL-SIYPTQSIVI-----ELKIVEAVAEISSAPELHIDETSTLRLEC 165
            |:|.: ...||..|.|     ||.::...::....|..:|.|...:.|.|
Human   108 YQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTC 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 17/84 (20%)
IGc2 55..125 CDD:197706 16/76 (21%)
CD86NP_787058.5 IgV_CD86 28..133 CDD:319336 30/125 (24%)
Ig 136..221 CDD:325142 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12529
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051626at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.