DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and PAPLN

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens


Alignment Length:278 Identity:69/278 - (24%)
Similarity:100/278 - (35%) Gaps:82/278 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAV 114
            |.|..|.|..|.|.......:..:|  :||.|.:       |||:.      |.....||.|..:
Human   919 VQAALGQLVRLSCSDDTAPESQAAW--QKDGQPI-------SSDRH------RLQFDGSLIIHPL 968

  Fly   115 REEDRGFYECQLSIYPTQSIVIELKI------VEAVAEISSAPELHIDETSTLRLECKLKRATEN 173
            :.||.|.|.|..:.....|..|:|:|      |.:.||:|..|:                  ..:
Human   969 QAEDAGTYSCGSTRPGRDSQKIQLRIIGGDMAVLSEAELSRFPQ------------------PRD 1015

  Fly   174 PAFVFWYHDSKMINYDSQGGFV--VTSIGQSNPQSGQFYRSSPANKSR--ATMP--MESSNGVLN 232
            ||..|           .|.|..  :.:|..|:||        |||:.|  ...|  :::|.|...
Human  1016 PAQDF-----------GQAGAAGPLGAIPSSHPQ--------PANRLRLDQNQPRVVDASPGQRI 1061

  Fly   233 SLLGSSDAIKAPAA-----NVPSSTPYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNA 292
            .:...::....||.     ..|.|:|    :||    |.|..| |.:.:|.....|.|||...|.
Human  1062 RMTCRAEGFPPPAIEWQRDGQPVSSP----RHQ----LQPDGS-LVISRVAVEDGGFYTCVAFNG 1117

  Fly   293 RPAS---ITVHVLRGEKT 307
            :...   :.:.|| ||.|
Human  1118 QDRDQRWVQLRVL-GELT 1134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 22/76 (29%)
IGc2 55..125 CDD:197706 19/69 (28%)
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767
Ig 914..>978 CDD:325142 21/73 (29%)
I-set 1049..1119 CDD:254352 20/78 (26%)
IG 1139..1219 CDD:214652
PLAC 1235..1267 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.