DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and dpr21

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:303 Identity:88/303 - (29%)
Similarity:133/303 - (43%) Gaps:75/303 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRK 78
            |.|:|.....:.::.....:|..:.     |||.|.::...|.   |.|.:|.....||||||.:
  Fly    33 LYLISENIVPMKRVLDRGPYFDTSA-----TKNVTSLVGITGH---LNCRIKNLGNKTVSWIRHR 89

  Fly    79 DFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIELKIVEA 143
            |..||||..||::||:||...:.:..|.|||:||..:..|.|.||||:|..|.....:...:||.
  Fly    90 DLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEP 154

  Fly   144 VAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDS-QGGF-VVTSIGQSNPQS 206
            :..|...||::||..||:.|.|.:|...:.|..|.|.|:::.||||| :||. |:|..|...   
  Fly   155 ITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDIT--- 216

  Fly   207 GQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSVSV 271
                                                                  ::|||      
  Fly   217 ------------------------------------------------------TSYLL------ 221

  Fly   272 LTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHAN 314
              :::.:...:|.|||.||||...|:.||:|:|:..||:|.::
  Fly   222 --IQRASIADSGQYTCLPSNANSKSVNVHILKGDHPAAVQKSH 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 33/76 (43%)
IGc2 55..125 CDD:197706 31/69 (45%)
dpr21NP_001163838.2 Ig 71..149 CDD:299845 34/77 (44%)
IG_like 71..140 CDD:214653 33/68 (49%)
IG_like 162..249 CDD:214653 36/151 (24%)
IGc2 169..242 CDD:197706 30/137 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.