DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and KIRREL3

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:382 Identity:78/382 - (20%)
Similarity:117/382 - (30%) Gaps:142/382 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VVKVNSPAT-----------VSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVRE 116
            ||....|.|           |.||  ||...|.||... ||..::||......|...|:|.....
Human    64 VVVSGQPVTLLCAIPEYDGFVLWI--KDGLALGVGRDL-SSYPQYLVVGNHLSGEHHLKILRAEL 125

  Fly   117 EDRGFYECQLSIYPTQSIVIELKIVEAVAE--ISSAPELHIDETSTLRLECKLKRATENPAFVFW 179
            :|...||||......:|....|.::....:  |...|.:.:.....|.|.|....| :..|.:.|
Human   126 QDDAVYECQAIQAAIRSRPARLTVLVPPDDPVILGGPVISLRAGDPLNLTCHADNA-KPAASIIW 189

  Fly   180 YHDSKMIN---------YDSQGGFVVTS--IGQSNPQSGQ------------------------- 208
            ....::||         .|.:...:|::  |...:.::||                         
Human   190 LRKGEVINGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQH 254

  Fly   209 --------------------FYRSSPANKS--------RATMPMESSNGVLNSLLG---SSDAIK 242
                                |:.|:.||.:        |..:..|:|..|..:.:.   .|:.:.
Human   255 PPLVNLSVEPQPVLEDNVVTFHCSAKANPAVTQYRWAKRGQIIKEASGEVYRTTVDYTYFSEPVS 319

  Fly   243 APAANVPSST-----------PYMTQQHQS-------------AYLLNPSVSV------------ 271
            ....|...||           |.||.:.||             |:..|||:::            
Human   320 CEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLVDLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLS 384

  Fly   272 ----LTVKQVNFRHAGNYTC------APSNARPASITV------------HVLRGEK 306
                ||:|.|....||.|.|      ..:..|..::||            |.|.|||
Human   385 NEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEK 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 24/74 (32%)
IGc2 55..125 CDD:197706 22/72 (31%)
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845 26/87 (30%)
IG_like 60..149 CDD:214653 26/87 (30%)
I-set 156..249 CDD:254352 15/93 (16%)
Ig2_KIRREL3-like 171..252 CDD:143236 13/81 (16%)
Ig_2 260..337 CDD:290606 12/76 (16%)
I-set 341..422 CDD:254352 18/80 (23%)
IGc2 355..406 CDD:197706 12/50 (24%)
Ig5_KIRREL3 424..521 CDD:143306 5/18 (28%)
IG_like 432..521 CDD:214653 5/10 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.