DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and nectin4b

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_001334985.6 Gene:nectin4b / 794920 ZFINID:ZDB-GENE-070912-114 Length:570 Species:Danio rerio


Alignment Length:332 Identity:71/332 - (21%)
Similarity:116/332 - (34%) Gaps:74/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GGLAILPCVVKVNSPAT---VSWIRR----KDFQLLTVGLSTHS-------------------SD 93
            |..|.|.||.......|   |:|.|.    |..|::| |..|..                   :|
Zfish    34 GSEARLKCVFVAPRDVTVVQVTWSRHTPAGKTQQIIT-GHYTEGPKVSPEFADGFRFESPDPLTD 97

  Fly    94 KRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIELKIVEAVAEISSAPELHIDET 158
            ...|:|:|         ::|    |.|.|.|.::.:|:.:....:.:...:..|||...:.:.|.
Zfish    98 STLLIENT---------VRA----DEGVYTCSIATFPSGNFQRRISLSVWMYPISSVEHVVLKEG 149

  Fly   159 STLRLECKLKRATENPAFVFWYHD--SKMINYDSQGGFVVT--SIGQSNPQSGQ---------FY 210
            .:..:....:.....||.:.|..|  .:..|....||.|.|  |:..|...:||         .|
Zfish   150 QSYGIAASCRAVAHPPARLSWDTDVSGQSQNRSGDGGVVTTQFSLYPSRSMNGQKLDCLVWHPVY 214

  Fly   211 RSSP--ANKSRATMPMES-SNGVLNSLLGSSDA-IKAPAANVPSSTPYMTQQHQSAYLLNPSVSV 271
            ....  |||.....|.:: :.|..:..:|||.: |:......|  .|......:|..:|...|.|
Zfish   215 EEPHRLANKLVVQFPPDAEAVGSGSWQIGSSGSEIRCLVKGNP--LPQNVSWSRSDGVLPSGVLV 277

  Fly   272 LTVKQVNFR-----HAGNYTCAPSN---ARPASITVHV--LRGEKTAAMQHANRSILDTETNGNG 326
            ...:.|..|     ..|.|.|...|   ...|..|:.:  :|.|.:.:..|....::     |..
Zfish   278 QKDRLVFSRPLQQTDEGVYVCRTHNTLGVAKAEFTLQIDAVRSEFSISSSHTLLIVI-----GAA 337

  Fly   327 TFGLITL 333
            :.|::.|
Zfish   338 SAGVLVL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 23/97 (24%)
Ig strand B 58..62 CDD:409353 2/3 (67%)
Ig strand C 71..75 CDD:409353 2/6 (33%)
Ig strand E 107..111 CDD:409353 0/3 (0%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250 10/40 (25%)
Ig strand E 270..274 CDD:409551 1/3 (33%)
Ig strand F 284..289 CDD:409551 2/4 (50%)
nectin4bXP_001334985.6 Ig 34..134 CDD:472250 24/113 (21%)
Ig strand B 37..41 CDD:409471 2/3 (67%)
Ig strand C 53..57 CDD:409471 1/3 (33%)
Ig strand E 98..102 CDD:409471 0/3 (0%)
Ig strand F 112..117 CDD:409471 2/4 (50%)
Ig strand G 126..129 CDD:409471 0/2 (0%)
Ig 146..226 CDD:472250 18/79 (23%)
Ig strand B 154..158 CDD:409501 0/3 (0%)
Ig strand C 167..171 CDD:409501 0/3 (0%)
Ig strand E 190..194 CDD:409501 1/3 (33%)
Ig strand F 204..209 CDD:409501 0/4 (0%)
Ig strand G 219..222 CDD:409501 0/2 (0%)
Ig 248..315 CDD:472250 15/68 (22%)
Ig strand B 248..251 CDD:409390 1/2 (50%)
Ig strand C 261..265 CDD:409390 0/3 (0%)
Ig strand E 281..285 CDD:409390 1/3 (33%)
Ig strand F 295..300 CDD:409390 2/4 (50%)
Ig strand G 308..311 CDD:409390 1/2 (50%)

Return to query results.
Submit another query.