DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and DIP-epsilon

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:438 Identity:100/438 - (22%)
Similarity:154/438 - (35%) Gaps:126/438 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HLHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFN-----TKNNTRVIAQKGGLAILPCVVKV 66
            ::.|.|.:....:..:|.|...::.|..|:||.:..:     |.....:....|....|.|.||.
  Fly    13 YVGLGCLIASSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKN 77

  Fly    67 NSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGH--WSLRIKAVREEDRGFYECQLSIY 129
            .....|:|:..:...:|||.....:.:.|..|.|.:|..|  |.|.|..|:|||||.|.||::..
  Fly    78 LGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTV 142

  Fly   130 --PTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQG 192
              .||...:::.:...:.:..::.::.:.|...:.|.||.|.:.| |. :.|..|        .|
  Fly   143 TAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPE-PT-IKWKRD--------DG 197

  Fly   193 GFVVTSIGQSNPQSGQFYRSSPANKSRATMPME--------------------SSNGVLNSLLGS 237
            ..:|                  .||:.....:|                    :||||..|:   
  Fly   198 NKIV------------------INKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSV--- 241

  Fly   238 SDAIKAPA----------------------------ANVPSSTPYMTQQH------QSAYLL--- 265
            |..||...                            || |:|..|.|:::      .|.|..   
  Fly   242 SKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEAN-PTSLNYWTRENDQMITESSKYKTETI 305

  Fly   266 --NPSVSV---LTVKQVNFRHAGNYTCAPSNAR-------------PASI----TVHVLRGEKTA 308
              :||...   ||:..|.....|||.|...|.|             |.:.    |...||...|.
  Fly   306 PGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTT 370

  Fly   309 AMQHANRSILDTETNGNGTFGLITLGGLNGTSGVTLAG--GILYFSGL 354
            |.:.|....::|..|||| .|::   |...|:.|..:|  .|.|.|.|
  Fly   371 AAEIALDGYINTPLNGNG-IGIV---GEGPTNSVIASGKSSIKYLSNL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 27/78 (35%)
Ig strand B 58..62 CDD:409353 1/3 (33%)
Ig strand C 71..75 CDD:409353 1/3 (33%)
Ig strand E 107..111 CDD:409353 2/3 (67%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250 12/57 (21%)
Ig strand E 270..274 CDD:409551 1/6 (17%)
Ig strand F 284..289 CDD:409551 3/4 (75%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 29/95 (31%)
Ig strand B 69..73 CDD:409353 1/3 (33%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 117..124 CDD:409353 3/6 (50%)
Ig 157..249 CDD:472250 22/122 (18%)
Ig strand B 176..180 CDD:409289 1/3 (33%)
Ig strand C 189..193 CDD:409289 0/4 (0%)
Ig strand E 213..218 CDD:409289 0/4 (0%)
Ig strand F 228..233 CDD:409289 0/4 (0%)
Ig strand G 242..245 CDD:409289 1/2 (50%)
IG_like 267..348 CDD:214653 19/81 (23%)
Ig strand C 283..287 CDD:409394 1/3 (33%)
Ig strand E 313..319 CDD:409394 1/5 (20%)
Ig strand F 329..334 CDD:409394 3/4 (75%)

Return to query results.
Submit another query.