| Sequence 1: | NP_001260336.1 | Gene: | dpr19 / 34408 | FlyBaseID: | FBgn0032233 | Length: | 385 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006510620.1 | Gene: | Kirrel3 / 67703 | MGIID: | 1914953 | Length: | 803 | Species: | Mus musculus |
| Alignment Length: | 493 | Identity: | 99/493 - (20%) |
|---|---|---|---|
| Similarity: | 154/493 - (31%) | Gaps: | 165/493 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MEPKRWHLHLSCFLLLLSSTFS-DVGKITSSQNH-----FGNTLQSQFNTKNNTRV--------- 50
Fly 51 -IAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAV 114
Fly 115 REEDRGFYECQLSIYPTQSIVIELKIVEAVAE--ISSAPELHIDETSTLRLECKLKRATENPAFV 177
Fly 178 FWYHDSKMIN---------YDSQGGFVVTS--IGQSNPQSGQ----------------------- 208
Fly 209 ----------------------FYRSSPANKS--------RATMPMESSNGVLNSLLG---SSDA 240
Fly 241 IKAPAANVPSST-----------PYMTQQHQS-------------AYLLNPSVSV---------- 271
Fly 272 ------LTVKQVNFRHAGNYTC------APSNARPASITV------------HVLRGEK------ 306
Fly 307 TAAMQHANRSILDTETN--GNGTFGLITLGGLNGTSGV 342 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr19 | NP_001260336.1 | IG_like | 50..127 | CDD:214653 | 24/86 (28%) |
| IGc2 | 55..125 | CDD:197706 | 21/69 (30%) | ||
| Kirrel3 | XP_006510620.1 | IG_like | 54..143 | CDD:214653 | 25/92 (27%) |
| Ig strand A' | 56..60 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 64..71 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 78..82 | CDD:409353 | 3/5 (60%) | ||
| Ig strand C' | 84..87 | CDD:409353 | 0/2 (0%) | ||
| Ig strand D | 97..101 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 104..116 | CDD:409353 | 3/11 (27%) | ||
| Ig strand G | 132..143 | CDD:409353 | 2/10 (20%) | ||
| IgI_2_KIRREL3-like | 149..246 | CDD:409416 | 15/97 (15%) | ||
| Ig strand B | 166..170 | CDD:409416 | 2/3 (67%) | ||
| Ig strand C | 180..184 | CDD:409416 | 0/3 (0%) | ||
| Ig strand E | 210..214 | CDD:409416 | 0/3 (0%) | ||
| Ig strand F | 224..229 | CDD:409416 | 0/4 (0%) | ||
| Ig strand G | 239..242 | CDD:409416 | 0/2 (0%) | ||
| Ig | <267..334 | CDD:416386 | 11/66 (17%) | ||
| Ig strand B | 267..274 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 279..286 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C' | 288..291 | CDD:409353 | 0/2 (0%) | ||
| Ig strand D | 298..302 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 304..310 | CDD:409353 | 0/5 (0%) | ||
| Ig strand G | 321..334 | CDD:409353 | 2/12 (17%) | ||
| Ig | 335..416 | CDD:416386 | 18/80 (23%) | ||
| Ig strand A' | 343..347 | CDD:409353 | 1/3 (33%) | ||
| Ig strand B | 350..360 | CDD:409353 | 1/9 (11%) | ||
| Ig strand C | 365..371 | CDD:409353 | 0/5 (0%) | ||
| Ig strand E | 381..387 | CDD:409353 | 2/5 (40%) | ||
| IgI_5_KIRREL3 | 418..515 | CDD:409479 | 14/62 (23%) | ||
| Ig strand B | 436..440 | CDD:409479 | 0/3 (0%) | ||
| Ig strand C | 450..454 | CDD:409479 | 1/3 (33%) | ||
| Ig strand E | 481..485 | CDD:409479 | |||
| Ig strand F | 496..501 | CDD:409479 | |||
| Ig strand G | 509..512 | CDD:409479 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||