DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and Cd86

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_064466.1 Gene:Cd86 / 56822 RGDID:628714 Length:313 Species:Rattus norvegicus


Alignment Length:238 Identity:53/238 - (22%)
Similarity:84/238 - (35%) Gaps:81/238 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPC-VVKVN--SP 69
            ::|.....:|:...||...: ..|.:|.:|                    |.||| ..|..  ||
  Rat    12 MYLGILFSVLAYLLSDAVPV-KRQAYFNST--------------------AYLPCPFTKAQNISP 55

  Fly    70 A--TVSWIRRKDFQLLTVGLSTHSSDKRFLVEH-----------TRHMGHWS-------LRIKAV 114
            :  .|.|..||               |..|.||           .:::|..|       ||:..|
  Rat    56 SELVVFWQDRK---------------KSVLYEHYLGAEKLDNVNAKYLGRTSFDRDNQALRLHNV 105

  Fly   115 REEDRGFYECQL-SIYPTQSIVI-----ELKIVEAVAEISSAPELHIDETST----LRLECKLKR 169
            :.:|.|.|:|.: ...||.||::     ||.::...:|    ||:...:..|    :.|.|..|:
  Rat   106 QIKDTGLYDCFIQQKTPTGSIILQQWETELSVIANFSE----PEIEEAQNETRNTGINLTCSSKQ 166

  Fly   170 ATENPAFVFW--------YHDSKMINYDSQGGFVVTSIGQSNP 204
            ....|..:::        |.|:..|:.|:.......||..|.|
  Rat   167 GYPKPTKMYFLITNSTNEYGDNMQISQDNVTKLFSVSISLSLP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 24/100 (24%)
IGc2 55..125 CDD:197706 23/92 (25%)
Cd86NP_064466.1 IGv 40..117 CDD:214650 25/111 (23%)
Ig 143..224 CDD:299845 16/71 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051626at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.