DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and igsf9ba

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_009289969.2 Gene:igsf9ba / 567389 ZFINID:ZDB-GENE-060503-729 Length:1475 Species:Danio rerio


Alignment Length:365 Identity:77/365 - (21%)
Similarity:138/365 - (37%) Gaps:88/365 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EPKRWHLHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFN---TKNNT---RVIAQKGGLAIL 60
            |.:.|:   .|.:|:|...:...        |.|:.:....|   |.::|   .|.|::||...|
Zfish   106 EDQGWY---ECRVLMLEQQYDTF--------HNGSWVHLTVNAPPTFSDTPPQYVEAREGGSITL 159

  Fly    61 PCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQ 125
            .|....|....|:|:|..| ||        :|.:::.|      ...||.::|:..||||.|.|:
Zfish   160 TCTAFGNPKPVVTWLREGD-QL--------TSTRKYTV------SDGSLTVQAITREDRGAYSCR 209

  Fly   126 LSIYPTQSIVIELKIVEAVAEISSAPE-LHIDETSTLRLECKLKRATENPAFV-FWYHDSKMINY 188
            ......:::.....:|:....|.:.|| :.::.:...:..|:.:....|..:. :|..|:.....
Zfish   210 AHSDQGEALHTTRLLVQGPPYIVTPPENITVNISQNAQFTCQAEAYPGNLTYTWYWEEDNVYFKN 274

  Fly   189 DSQ--------GGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPA 245
            |.:        |..::..:   .|:....|..||:|.                 ||.|       
Zfish   275 DLKLRVRIFIDGTLIIYRV---KPEDAGKYTCSPSNS-----------------LGIS------- 312

  Fly   246 ANVPSSTPYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITV------HVLRG 304
               ||::.|:|.|:.:..:..|.|..:..|.     :|...| |.:|.|...:|      :.||.
Zfish   313 ---PSASAYLTVQYPARVVNMPPVIYVPRKL-----SGIIRC-PVDANPPVTSVRWEKDGYPLRI 368

  Fly   305 EK---TAAMQHANRSILDTETNGNGTFGLITLGGLNGTSG 341
            ||   .:.|...:..:.:...:..||:..:....| ||.|
Zfish   369 EKYPGWSQMTDGSIRVAEVTEDSLGTYTCVPYNVL-GTMG 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 24/76 (32%)
IGc2 55..125 CDD:197706 21/69 (30%)
igsf9baXP_009289969.2 IG 30..115 CDD:214652 3/11 (27%)
I-set 139..225 CDD:254352 26/100 (26%)
I-set 229..321 CDD:333254 20/121 (17%)
Ig 345..415 CDD:325142 16/65 (25%)
Ig 438..503 CDD:319273
FN3 511..606 CDD:238020
FN3 622..706 CDD:238020
Atrophin-1 <924..1361 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.