DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and paplna

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_005169942.1 Gene:paplna / 562930 ZFINID:ZDB-GENE-070815-4 Length:1187 Species:Danio rerio


Alignment Length:283 Identity:65/283 - (22%)
Similarity:121/283 - (42%) Gaps:56/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EPKRWHLHLSCFLLLLSSTFSDVG--KITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPC-V 63
            :.||.|.::  :|.:..|:.::.|  ::.|||::...: .|:||...:..|.|:.|..|.|.| |
Zfish   908 DDKRDHRYI--YLSVSGSSQNNAGISEVDSSQSYTSQS-SSRFNIDYSPLVEARAGQTAKLQCSV 969

  Fly    64 VKVNS--PATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQL 126
            :.|::  ..|:.|.|        .|...:|      :.|::| ...:|.||.:..:|.|.|.|.:
Zfish   970 LPVSAIHAVTIHWSR--------AGQPLNS------LRHSQH-SDGTLVIKQLTADDSGLYTCTV 1019

  Fly   127 S-IYPTQSIVIELKIVEAVAEISSAP-ELHIDETSTLRLECKLKRATENPAFVFWYH-------D 182
            : ....:...::|:::..: .|:.|| ::.:.:.||.:|.|.:.....|   |.|..       |
Zfish  1020 TDAQKFEERQVQLRVLGDL-RITKAPIDVDVVQGSTAQLACVVTGENVN---VGWSRNGVPVRPD 1080

  Fly   183 SKMINYDSQGGFVVTSIGQS--------NPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSD 239
            ...::..:.|..::.:: ||        |..:|....|:.|....|..|.:..:|   ....|||
Zfish  1081 GHRVHVSADGTLILNNV-QSVDEGTYTCNAYTGTLSVSAAAEIRLAKTPQQDIDG---GQFSSSD 1141

  Fly   240 AIKAP-AANVP-------SSTPY 254
            .:..| .||..       .|:||
Zfish  1142 CVDQPELANCKLIVYARLCSSPY 1164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 22/79 (28%)
IGc2 55..125 CDD:197706 19/72 (26%)
paplnaXP_005169942.1 TSP1 24..75 CDD:214559
ADAM_spacer1 181..293 CDD:310520
TSP1 303..356 CDD:214559
TSP1 388..442 CDD:214559
TSP1 449..498 CDD:214559
TSP1 504..557 CDD:214559
KU 720..771 CDD:238057
Ig_3 839..906 CDD:316449
IGc2 960..1022 CDD:197706 20/76 (26%)
I-set 1039..1121 CDD:333254 17/85 (20%)
PLAC 1142..1173 CDD:312271 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.