DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and pvrl2l

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001417821.1 Gene:pvrl2l / 560933 ZFINID:ZDB-GENE-060503-249 Length:508 Species:Danio rerio


Alignment Length:412 Identity:84/412 - (20%)
Similarity:143/412 - (34%) Gaps:121/412 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPAT--- 71
            ::|.|:|.:.       :.|||..:...::.::      .|.|...|...|.|.. .||..|   
Zfish     7 INCCLVLAAC-------LLSSQAVWSQRVRVEY------EVTAYPNGSVNLRCEF-TNSGTTKLT 57

  Fly    72 -VSWI---RRKDFQLLTV-----GLSTHSSDKRFLVEHTR-HMGHWSLRIKAVREEDRGFYECQL 126
             |||:   ...|.|.:.|     |.|..:.|....|:.|: .:.:.|:||..:|..|.|.|.|:.
Zfish    58 QVSWMFERAENDRQNIAVFHPQYGASFPNKDFEGRVKFTQGSLENPSIRIDKLRMADAGRYICEY 122

  Fly   127 SIYP------TQSIVIELK-----------------IVEAVAEISSAPELHIDETSTLRLECKLK 168
            :.||      |.::::..|                 :|...|.....||..|...:|:.......
Zfish   123 ATYPSGNEQGTTTLIMLAKPKNSATAIPVRAGTSEVVVATCAAAQGKPEATISWITTITGRYNHT 187

  Fly   169 RATENPAFVFWYHDSKMINYDSQGGFVVTS-IGQSNPQSGQFYRSSPANKSRATMPMESSNGVLN 232
            ...|:...|....:.:||....:.|..:|. :.|......:.:......:...|:.::..:.  |
Zfish   188 SVPESDGTVTVKSEYRMIPTPVENGKEITCVVNQRTQMEDKVFNLKLVVEYPPTVTIDGYDN--N 250

  Fly   233 SLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTC-APSNARPAS 296
            ..:|.:|                      .||                     || |.:|..|:.
Zfish   251 WYMGRTD----------------------VYL---------------------TCEADANPEPSE 272

  Fly   297 ITVHVLRGEKTAAMQ-HANRSI---LDTETN-----------GNGTFGLITL---GGLNGTSGVT 343
            |:..|..|:..:::: ..||.:   :|...|           |.|...|:.|   ...:.:|...
Zfish   273 ISWTVATGQMPSSVRVEENRLLVRKVDETVNTTFVCEVKNRLGTGKKELVALVIESTEDPSSAGV 337

  Fly   344 LAGGILYFSGLFL---LMGAVV 362
            :||.||   |.||   |:||:|
Zfish   338 VAGAIL---GSFLALVLVGALV 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 27/89 (30%)
Ig strand B 58..62 CDD:409353 1/3 (33%)
Ig strand C 71..75 CDD:409353 3/7 (43%)
Ig strand E 107..111 CDD:409353 1/3 (33%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250 5/33 (15%)
Ig strand E 270..274 CDD:409551 0/3 (0%)
Ig strand F 284..289 CDD:409551 2/5 (40%)
pvrl2lNP_001417821.1 IgV_1_PVR_like 26..138 CDD:409383 30/118 (25%)
FR1 26..49 CDD:409383 5/29 (17%)
Ig strand A 26..30 CDD:409383 0/3 (0%)
Ig strand A' 32..36 CDD:409383 1/9 (11%)
Ig strand B 41..49 CDD:409383 2/8 (25%)
CDR1 50..56 CDD:409383 3/5 (60%)
FR2 57..63 CDD:409383 3/5 (60%)
Ig strand C 58..63 CDD:409383 3/4 (75%)
CDR2 64..84 CDD:409383 4/19 (21%)
Ig strand C' 74..79 CDD:409383 1/4 (25%)
Ig strand C' 81..85 CDD:409383 2/3 (67%)
FR3 85..122 CDD:409383 11/36 (31%)
Ig strand D 93..96 CDD:409383 1/2 (50%)
Ig strand E 102..109 CDD:409383 3/6 (50%)
Ig strand F 116..124 CDD:409383 3/7 (43%)
CDR3 125..128 CDD:409383 2/2 (100%)
Ig strand G 128..138 CDD:409383 1/9 (11%)
FR4 129..138 CDD:409383 1/8 (13%)
IgC1_2_Nectin-2_Necl-5_like 142..237 CDD:409500 13/94 (14%)
Ig strand A 142..148 CDD:409500 0/5 (0%)
Ig strand B 159..166 CDD:409500 2/6 (33%)
Ig strand C 171..177 CDD:409500 2/5 (40%)
Ig strand C' 179..181 CDD:409500 1/1 (100%)
Ig strand D 184..192 CDD:409500 0/7 (0%)
Ig strand E 196..204 CDD:409500 1/7 (14%)
Ig strand F 214..221 CDD:409500 1/6 (17%)
Ig strand G 227..233 CDD:409500 0/5 (0%)
Ig 240..325 CDD:472250 21/129 (16%)
Ig strand B 258..262 CDD:409524 2/24 (8%)
Ig strand C 272..276 CDD:409524 1/3 (33%)
Ig strand E 291..295 CDD:409524 2/3 (67%)
Ig strand F 305..310 CDD:409524 0/4 (0%)
Ig strand G 320..323 CDD:409524 1/2 (50%)

Return to query results.
Submit another query.