DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and lrit3a

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001122166.1 Gene:lrit3a / 558559 ZFINID:ZDB-GENE-080723-63 Length:636 Species:Danio rerio


Alignment Length:174 Identity:43/174 - (24%)
Similarity:72/174 - (41%) Gaps:37/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 PELHIDETSTLRLECKLKRATENPAFVFWYHD---SKMINYDSQGGFVVTSIGQ----SNPQ--S 206
            |..:..:.:.|.|:       :||    ||.|   ||:|......|..|..:.|    |.|:  |
Zfish   184 PSANTSQKTVLGLQ-------DNP----WYCDCRISKLIELSKMAGIPVVLMDQVLTCSGPEHLS 237

  Fly   207 GQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSV-- 269
            |..::.:..::......|.|:..: .|.|||:..::..|...|:.|...|....|  ::|.:|  
Zfish   238 GVLFQRAELDQCVKPTVMTSATKI-TSPLGSNVLLRCDANGFPTPTLLWTTADGS--VVNNTVVQ 299

  Fly   270 ---------SVLTVKQVNFRHAGNYTCAPSNA---RPASITVHV 301
                     |:|::..:.|:.||:|.|...|.   ..|.||:.|
Zfish   300 ESPGEGVRWSILSLHSIVFKDAGDYRCKAKNVAGNAEAYITLSV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653
IGc2 55..125 CDD:197706
lrit3aNP_001122166.1 LRR_8 81..141 CDD:290566
leucine-rich repeat 83..106 CDD:275378
LRR_4 107..145 CDD:289563
leucine-rich repeat 107..130 CDD:275378
LRR_8 129..>171 CDD:290566
LRR_4 129..170 CDD:289563
leucine-rich repeat 131..154 CDD:275378
leucine-rich repeat 155..168 CDD:275378
TPKR_C2 199..249 CDD:301599 15/53 (28%)
Ig 252..343 CDD:299845 24/93 (26%)
IG_like 261..343 CDD:214653 22/84 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.