DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and iglon5

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:285 Identity:63/285 - (22%)
Similarity:116/285 - (40%) Gaps:60/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NNTRVIAQKGGLAILPCVVKVNSPAT-VSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSL 109
            :|..|:  :|...:|.|  |::...| .:|:.|.:  :|..|....|.|.|..:|:..: ..:|:
Zfish    34 DNITVL--EGESVVLRC--KIDEEVTHKAWLNRSN--ILFTGTDKWSLDSRVSLENNNN-SDFSI 91

  Fly   110 RIKAVREEDRGFYEC--QLSIYP-TQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRAT 171
            ||:.|...|.|.|.|  |....| |..:.:.:::...:..||.  :..::|...:.|.|   .|.
Zfish    92 RIERVMVADEGPYTCSFQARNKPRTAHVYLIVQVPARIVNISQ--DKSVNEGEDVNLFC---LAV 151

  Fly   172 ENPAFVFWYHDSK--MINYDSQGGFV---------------VTSIGQSNPQSGQFYRSSPANKSR 219
            ..|.....:.|.|  ::|   :|.|:               :|:.|.:.|.:         .|.:
Zfish   152 GRPEPTITWKDFKYGLLN---EGEFLEITEIKRHQAEDFECITNNGVAPPDT---------RKVK 204

  Fly   220 ATM---PMESSNGVLNSLLGSSDAIKAPAANVPSST---------PYMTQQHQSAYLLNPSV-SV 271
            .|:   |:.:....:.:.:|.:..::..|..||:::         |  .:...:..:.|... |:
Zfish   205 VTVNYPPIITDVKNMPAQVGKTAILRCEAMAVPTASFEWYRDDRRP--VESDNTLKIKNEKTRSL 267

  Fly   272 LTVKQVNFRHAGNYTCAPSNARPAS 296
            |....|..:|.|||||..||...||
Zfish   268 LLFTNVTEKHFGNYTCFASNRLGAS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 23/79 (29%)
Ig strand B 58..62 CDD:409353 1/3 (33%)
Ig strand C 71..75 CDD:409353 1/4 (25%)
Ig strand E 107..111 CDD:409353 1/3 (33%)
Ig strand F 121..126 CDD:409353 2/6 (33%)
Ig <265..298 CDD:472250 14/33 (42%)
Ig strand E 270..274 CDD:409551 2/3 (67%)
Ig strand F 284..289 CDD:409551 4/4 (100%)
iglon5NP_001017775.2 Ig 35..123 CDD:472250 26/94 (28%)
Ig strand B 44..48 CDD:409353 1/3 (33%)
Ig strand C 56..60 CDD:409353 0/3 (0%)
Ig strand E 89..93 CDD:409353 1/3 (33%)
Ig strand F 103..108 CDD:409353 2/4 (50%)
Ig strand G 116..119 CDD:409353 1/2 (50%)
Ig 122..207 CDD:472250 16/101 (16%)
Ig strand B 144..148 CDD:409353 1/3 (33%)
Ig strand C 157..161 CDD:409353 0/3 (0%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig strand F 186..191 CDD:409353 0/4 (0%)
Ig strand G 200..203 CDD:409353 0/11 (0%)
Ig_3 210..287 CDD:464046 16/78 (21%)

Return to query results.
Submit another query.