| Sequence 1: | NP_001260336.1 | Gene: | dpr19 / 34408 | FlyBaseID: | FBgn0032233 | Length: | 385 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001338930.1 | Gene: | NTM / 50863 | HGNCID: | 17941 | Length: | 367 | Species: | Homo sapiens |
| Alignment Length: | 330 | Identity: | 83/330 - (25%) |
|---|---|---|---|
| Similarity: | 131/330 - (39%) | Gaps: | 66/330 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 50 VIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKR-FLVEHTRHMGHWSLRIKA 113
Fly 114 VREEDRGFYEC--QLSIYP-TQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENP- 174
Fly 175 AFVFWYHDS-KMINYDSQGGFVVTSIGQSNPQSGQFYRSSPANKSRATM-----------PMESS 227
Fly 228 NGVLNSLLGSSDAIKAPAANVPSS-------TPYMTQQHQSAYLLN-PSVSVLTVKQVNFRHAGN 284
Fly 285 YTCAPSNA--------------RPASITVHVLRGEKTAAMQHANRSILDTETNGNGTFGLITLGG 335
Fly 336 LNGTS 340 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr19 | NP_001260336.1 | IG_like | 50..127 | CDD:214653 | 23/79 (29%) |
| IGc2 | 55..125 | CDD:197706 | 21/72 (29%) | ||
| NTM | NP_001338930.1 | Ig | 44..132 | CDD:416386 | 25/91 (27%) |
| Ig strand A' | 44..49 | CDD:409353 | 1/3 (33%) | ||
| Ig strand B | 51..59 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 59..63 | CDD:409353 | 1/4 (25%) | ||
| FR2 | 64..70 | CDD:409353 | 2/5 (40%) | ||
| Ig strand C | 64..70 | CDD:409353 | 2/5 (40%) | ||
| CDR2 | 71..83 | CDD:409353 | 3/13 (23%) | ||
| Ig strand C' | 72..76 | CDD:409353 | 0/5 (0%) | ||
| Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 84..118 | CDD:409353 | 11/35 (31%) | ||
| Ig strand D | 87..94 | CDD:409353 | 2/6 (33%) | ||
| Ig strand E | 97..103 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 123..132 | CDD:409353 | 2/8 (25%) | ||
| FR4 | 125..132 | CDD:409353 | 1/6 (17%) | ||
| Ig_3 | 136..205 | CDD:404760 | 23/75 (31%) | ||
| Ig strand A' | 142..147 | CDD:409353 | 2/6 (33%) | ||
| Ig strand B | 153..160 | CDD:409353 | 2/9 (22%) | ||
| Ig strand C | 166..171 | CDD:409353 | 2/4 (50%) | ||
| Ig strand D | 177..180 | CDD:409353 | 0/2 (0%) | ||
| Ig strand E | 184..190 | CDD:409353 | 0/6 (0%) | ||
| Ig strand F | 197..204 | CDD:409353 | 3/7 (43%) | ||
| Ig strand G | 211..219 | CDD:409353 | 0/7 (0%) | ||
| Ig_3 | 222..299 | CDD:404760 | 17/76 (22%) | ||
| putative Ig strand A | 223..229 | CDD:409353 | 2/5 (40%) | ||
| Ig strand B | 239..243 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 252..256 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 278..282 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 292..297 | CDD:409353 | 4/4 (100%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||