DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and dpr6

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:324 Identity:97/324 - (29%)
Similarity:142/324 - (43%) Gaps:92/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTR 102
            ::..|:......|.|..|..|.|.|.|:..:..||||||.:|..:||||..|::||:||...|.:
  Fly    71 MEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQ 135

  Fly   103 HMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKL 167
            ....|:|:||..::.|.|.||||:|..|.:|..:.|.:|...|.|...|:||:|:.||:.|.|.:
  Fly   136 DTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTV 200

  Fly   168 KRATENPAFVFWYHDSKMINYD-SQGGF-VVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGV 230
            |.:.|.||::||||..::|||| |:||. |:|..|                              
  Fly   201 KFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKG------------------------------ 235

  Fly   231 LNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPA 295
                                               :.:.|.|.::..:...:|.|:||||||..|
  Fly   236 -----------------------------------DVTTSFLLIQNADLADSGKYSCAPSNADVA 265

  Fly   296 SITVHVLR------GEKTAAMQHANRSILDTETNGNG-TFGLITLGGLNGTSGVTLAGGILYFS 352
            |:.||||.      ||...|||          |..:| .:..:|:        |.|.|.:|.:|
  Fly   266 SVRVHVLNVRAIISGEHPEAMQ----------TGSSGCQYNWLTI--------VLLLGLVLCYS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 34/76 (45%)
IGc2 55..125 CDD:197706 30/69 (43%)
dpr6NP_001287018.1 V-set 79..174 CDD:284989 38/94 (40%)
IG_like 80..175 CDD:214653 38/94 (40%)
IG_like 184..271 CDD:214653 39/151 (26%)
IGc2 191..262 CDD:197706 30/135 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.