DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and OPCML

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:339 Identity:78/339 - (23%)
Similarity:131/339 - (38%) Gaps:68/339 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAV 114
            |..::|..|.|.|.:. :....|:|:.|.  .:|..|....|.|.|.:: .......:|:.|:.|
Human    45 VTVRQGESATLRCTID-DRVTRVAWLNRS--TILYAGNDKWSIDPRVII-LVNTPTQYSIMIQNV 105

  Fly   115 REEDRGFYEC--QLSIYP-TQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAF 176
            ...|.|.|.|  |...:| |..:.:.:::...:..|||  ::.::|.|::.|.| |......|. 
Human   106 DVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISS--DITVNEGSSVTLLC-LAIGRPEPT- 166

  Fly   177 VFWYHDSKMINYDSQGGFV-------VTSIGQSNPQSGQFYRSSPAN--------KSRATM---P 223
            |.|.|    ::.....|||       ::.|  ...|||: |..|..|        |.:.|:   |
Human   167 VTWRH----LSVKEGQGFVSEDEYLEISDI--KRDQSGE-YECSALNDVAAPDVRKVKITVNYPP 224

  Fly   224 MESSNGVLNSLLGSSDAIKAPAANVP-SSTPYMTQQHQSAYLLN-------PSVSVLTVKQVNFR 280
            ..|........:|....:...|:.|| :...:..::.:.|..|:       ..:|.||...|:.:
Human   225 YISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEK 289

  Fly   281 HAGNYTCAPSNA---RPASITVHVLRGEKTAAMQHANRSILDTETNGNGTFGLITLGGLNGTSGV 342
            ..|||||..:|.   ..||||::.:......|              |.|..       ::|.:..
Human   290 DYGNYTCVATNKLGNTNASITLYEISPSSAVA--------------GPGAV-------IDGVNSA 333

  Fly   343 TLAGGILYFSGLFL 356
            :.|...|:.||..|
Human   334 SRALACLWLSGTLL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 21/78 (27%)
IGc2 55..125 CDD:197706 19/71 (27%)
OPCMLNP_001306032.1 Ig 44..132 CDD:416386 23/90 (26%)
Ig strand A' 44..49 CDD:409353 1/3 (33%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 0/4 (0%)
FR2 64..70 CDD:409353 2/5 (40%)
Ig strand C 64..70 CDD:409353 2/5 (40%)
CDR2 71..83 CDD:409353 3/13 (23%)
Ig strand C' 72..76 CDD:409353 0/5 (0%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 9/34 (26%)
Ig strand D 87..94 CDD:409353 1/7 (14%)
Ig strand E 97..103 CDD:409353 1/5 (20%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 0/3 (0%)
Ig strand G 123..132 CDD:409353 2/8 (25%)
FR4 125..132 CDD:409353 1/6 (17%)
Ig_3 135..206 CDD:404760 21/81 (26%)
Ig strand A 135..138 CDD:409353 0/2 (0%)
Ig strand A' 144..148 CDD:409353 0/3 (0%)
Ig strand B 151..160 CDD:409353 4/9 (44%)
Ig strand C 165..170 CDD:409353 2/5 (40%)
Ig strand C' 171..174 CDD:409353 1/6 (17%)
Ig strand F 198..206 CDD:409353 3/8 (38%)
Ig 224..312 CDD:416386 22/87 (25%)
putative Ig strand A 224..230 CDD:409353 2/5 (40%)
Ig strand B 240..244 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 2/3 (67%)
Ig strand F 293..298 CDD:409353 4/4 (100%)
Ig strand G 306..309 CDD:409353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.