DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and NCAM2

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:351 Identity:69/351 - (19%)
Similarity:126/351 - (35%) Gaps:78/351 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLV--EHTRHMGHWSLRIKAVREEDRGFYECQLSI 128
            :..|.::.|...:..:::        |.:|.:|  |..|.    .|.|.....||.|.|.||.:.
Human    70 IGEPESIDWYNPQGEKII--------STQRVVVQKEGVRS----RLTIYNANIEDAGIYRCQATD 122

  Fly   129 Y--PTQSIVIELKIVEAVA--EISSAPELHIDETSTLRLECKLKRATENPA-FVFWYHDSKMINY 188
            .  .||...:.|:|.:.:.  |:.|..|....|.:  .:.|   |.:.:|| .|.|.:.::.:..
Human   123 AKGQTQEATVVLEIYQKLTFREVVSPQEFKQGEDA--EVVC---RVSSSPAPAVSWLYHNEEVTT 182

  Fly   189 DSQGGFVVTS-----IGQSNPQSGQFYRSSPANKSRA-----------------TMPMESSNGVL 231
            .|...|.:.:     |...|......||.....::|.                 :||.:|.|...
Human   183 ISDNRFAMLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPAISMPQKSFNATA 247

  Fly   232 NSLLGSSDAIKAPAANVPSSTPYMTQ---QHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSN-- 291
            ......:.:.:|..:..|:.:.:...   :....|:|..|.:.|||:.:.....|.|.|..:|  
Human   248 ERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPYVCRATNKA 312

  Fly   292 ---ARPASITV----HVLR---------GEKTAAMQHANRSILD----------TETNGNGTF-G 329
               .:.|.:.|    |:::         |:.|.........|.:          |.|.|:.:. |
Human   313 GEDEKQAFLQVFVQPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDG 377

  Fly   330 LITLGGLNGTSGVTLAGGILYFSGLF 355
            .|.:.|.:|:|.:.:....|..||.:
Human   378 RIEVKGQHGSSSLHIKDVKLSDSGRY 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 15/62 (24%)
Ig strand B 58..62 CDD:409353
Ig strand C 71..75 CDD:409353 0/3 (0%)
Ig strand E 107..111 CDD:409353 1/3 (33%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250 10/37 (27%)
Ig strand E 270..274 CDD:409551 1/3 (33%)
Ig strand F 284..289 CDD:409551 2/4 (50%)
NCAM2XP_011527877.1 IgI_1_NCAM-2 46..138 CDD:409452 19/79 (24%)
Ig strand A 46..51 CDD:409452
Ig strand A' 54..58 CDD:409452
Ig strand B 60..70 CDD:409452 69/351 (20%)
Ig strand C 74..80 CDD:409452 1/5 (20%)
Ig strand C' 83..85 CDD:409452 0/1 (0%)
Ig strand D 91..97 CDD:409452 2/5 (40%)
Ig strand E 99..107 CDD:409452 3/11 (27%)
Ig strand F 114..121 CDD:409452 4/6 (67%)
Ig strand G 126..137 CDD:409452 3/10 (30%)
Ig 142..218 CDD:472250 16/80 (20%)
Ig strand C 170..174 CDD:409353 1/3 (33%)
Ig strand E 193..197 CDD:409353 0/3 (0%)
IgI_1_MuSK 234..323 CDD:409562 17/88 (19%)
Ig strand A 234..237 CDD:409562 0/2 (0%)
Ig strand A' 242..247 CDD:409562 2/4 (50%)
Ig strand B 253..260 CDD:409562 0/6 (0%)
Ig strand C 266..271 CDD:409562 0/4 (0%)
Ig strand C' 273..275 CDD:409562 0/1 (0%)
Ig strand D 282..285 CDD:409562 1/2 (50%)
Ig strand E 289..295 CDD:409562 3/5 (60%)
Ig strand F 302..309 CDD:409562 3/6 (50%)
Ig strand G 315..323 CDD:409562 1/7 (14%)
IgI_NCAM-2 325..422 CDD:143278 15/79 (19%)
Ig strand A 325..330 CDD:143278 1/4 (25%)
Ig strand A' 334..338 CDD:143278 0/3 (0%)
Ig strand B 342..350 CDD:143278 1/7 (14%)
Ig strand C 356..362 CDD:143278 0/5 (0%)
Ig strand C' 365..368 CDD:143278 0/2 (0%)
Ig strand D 378..384 CDD:143278 1/5 (20%)
Ig strand E 387..393 CDD:143278 1/5 (20%)
Ig strand F 401..409 CDD:143278 1/3 (33%)
Ig strand G 412..422 CDD:143278
Ig_3 426..504 CDD:464046
FN3 521..613 CDD:238020
fn3 619..703 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.