DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and NCAM1

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens


Alignment Length:411 Identity:90/411 - (21%)
Similarity:142/411 - (34%) Gaps:96/411 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWHLHLSCFLLLLSSTFSDVGK-ITSSQNHFGNTLQSQF-------NTKNNTRVIAQKGGLAILP 61
            |.|..:|. |.|.|..::|.|: |.::.|..|...||.:       ..:....|...:|....:.
Human   398 RSHARVSS-LTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNIT 461

  Fly    62 CVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYEC-- 124
            |.|.....||:||.|  |.|||.  .|.:|:.|.:......:     |.:....|.|.|.|.|  
Human   462 CEVFAYPSATISWFR--DGQLLP--SSNYSNIKIYNTPSASY-----LEVTPDSENDFGNYNCTA 517

  Fly   125 -------QLSIYPTQSIVIELKIVEAVAEISSAPELHIDETST------LRLECKLKRATENPAF 176
                   .|.....|:.......::.|...||..::..||...      |:.:.:.:...|....
Human   518 VNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWH 582

  Fly   177 VFWYHDSKMINYDSQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAI 241
            ..|| |:|..:.:.    :||.:| ..|::....|.:..|          ..| |..:..:|:..
Human   583 SKWY-DAKEASMEG----IVTIVG-LKPETTYAVRLAALN----------GKG-LGEISAASEFK 630

  Fly   242 KAPAANVPSSTPYMTQQHQSAYLLNPSVSVLTVKQVN----FRH-AGNYTCAPSNARP------- 294
            ..|....||:.....|..:.    ..|:.|..:||.:    .|| ...|....|..:|       
Human   631 TQPVQGEPSAPKLEGQMGED----GNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSG 691

  Fly   295 ------------ASITVHVL----RGEKTAAMQHANRSILDTETNGNGTFGLITLGGLNGTSGVT 343
                        |...|:|:    :|:..||......|...|....||          :.|||::
Human   692 SDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANG----------SPTSGLS 746

  Fly   344 LAG--GILYFSGLFLLMGAVV 362
            ...  |||..  :|:|:..||
Human   747 TGAIVGILIV--IFVLLLVVV 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 22/85 (26%)
IGc2 55..125 CDD:197706 21/78 (27%)
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652
Ig 211..307 CDD:325142
Ig 306..438 CDD:325142 13/40 (33%)
Ig_3 447..519 CDD:316449 22/80 (28%)
FN3 534..631 CDD:238020 20/113 (18%)
fn3 639..720 CDD:306538 15/84 (18%)
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.