DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and opcml

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:304 Identity:72/304 - (23%)
Similarity:126/304 - (41%) Gaps:51/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSL 109
            |:|  :..::|..|:|.|.:. |..:.|:|:.|.  .:|..|....|.|.|.::.:|. :..:|:
Zfish    39 KDN--ITVRQGDSAVLKCSMD-NKVSRVAWLNRT--TILFTGNEKWSLDPRVVLLNTA-VNEYSI 97

  Fly   110 RIKAVREEDRGFYECQ-LSIYPTQSIVIELKIVEAVAEI-SSAPELHIDETSTLRLECKLKRATE 172
            :|..|...|.|.|.|. |:....:|..:.| ||:..|.| :.:.::.::|.|.:.|.| |.....
Zfish    98 KILNVNLYDEGPYVCSILTNKKPESTKVHL-IVQVPARIVNVSTDVSVNEGSNVSLMC-LAIGRP 160

  Fly   173 NPAFVFWYHDSKMINYDSQGGFV---------------VTSIGQSNP--QSGQFYRSSPANKSRA 220
            .|:.::.:..||.....::|.:|               :||...|.|  ::.|...:.|...|||
Zfish   161 EPSILWKFRSSKGNRIVTEGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQVTVNYPPVISRA 225

  Fly   221 TMPMESSNGVLNSLLGSSDAIKAPAANVP-SSTPYMTQQHQSAYLLN----------PSVSVLTV 274
                 .|.|   :.:|....:...|:.|| :...:...:.:   :||          ...|:||.
Zfish   226 -----RSTG---TAVGQKGVLWCEASAVPLADFQWFKGERR---ILNGFNGVKIENKGKQSMLTF 279

  Fly   275 KQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSIL 318
            ..|:....|||||...|....:....:|.|  ..|:...|.:.|
Zfish   280 FNVSEEDYGNYTCVAINTLGITNASIILYG--PGAIHDVNNAAL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 21/77 (27%)
IGc2 55..125 CDD:197706 20/69 (29%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845 25/94 (27%)
IG_like 41..129 CDD:214653 25/94 (27%)
IG_like 139..216 CDD:214653 15/77 (19%)
IGc2 146..202 CDD:197706 11/56 (20%)
I-set 219..307 CDD:254352 22/98 (22%)
ig 223..307 CDD:278476 21/94 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.