DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and DIP-gamma

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:326 Identity:82/326 - (25%)
Similarity:122/326 - (37%) Gaps:90/326 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTK-------NNTRVIAQKGGLAILPCVVK 65
            |..:.|::|:.:|....|. |.:|:|..:   ||.:..       ||  |....|..|||.|.|:
  Fly     5 LQSTLFVILIMATKCGSGS-TQNQHHESS---SQLDPDPEFIGFINN--VTYPAGREAILACSVR 63

  Fly    66 VNSPATVSWIRRKDFQLLTV--GLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSI 128
            ......|.|:|..|..:|.:  .:.||::  |..|.| :.|..|.|:|..:||.|||.|.||::.
  Fly    64 NLGKNKVGWLRASDQTVLALQGRVVTHNA--RISVMH-QDMHTWKLKISKLRESDRGCYMCQINT 125

  Fly   129 YPTQSIV--IELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENP-AFVFW-YHDSKMINYD 189
            .|.:..|  |::::...:....|:.:|.:.|.....|.||   ||.|| ..|.| ..|.:||...
  Fly   126 SPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCK---ATGNPQPRVTWRREDGEMILIR 187

  Fly   190 SQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPY 254
            ..|                         ||..|.:||.||                         
  Fly   188 KPG-------------------------SRELMKVESYNG------------------------- 202

  Fly   255 MTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSILD 319
                           |.|.:.::..|..|.|.|..||..|.:::..|....:.|.|..|...:|.
  Fly   203 ---------------SSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLG 252

  Fly   320 T 320
            |
  Fly   253 T 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 29/78 (37%)
IGc2 55..125 CDD:197706 26/71 (37%)
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 33/96 (34%)
Ig 47..129 CDD:299845 31/86 (36%)
Ig 140..238 CDD:299845 33/165 (20%)
IG_like 247..355 CDD:214653 2/7 (29%)
Ig 256..351 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.