DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and dpr5

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:316 Identity:82/316 - (25%)
Similarity:137/316 - (43%) Gaps:82/316 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLSSTFSDVGKIT-SSQNHFGNTLQSQ----------------FNTKNNTRVIAQKGGLAILP 61
            ||::....:.|.|.: .|..:||:...::                |:...:..|||..|..|.|.
  Fly    47 LLVIMGLTAPVDKQSRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLH 111

  Fly    62 CVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQL 126
            |.|:......|||||::|..:||:|:.|:::|:|||..|..:...|.|:|.:|::.|.|.||||:
  Fly   112 CRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQV 176

  Fly   127 SIYPTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQ 191
            |..|..|:..:|.:|.:.|:|.:..||.|...|.:.|.|...:|......:.|:.|:::::..::
  Fly   177 STEPKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDSAR 241

  Fly   192 GGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMT 256
            ||..|.|..|                      |::||                            
  Fly   242 GGIRVESEQQ----------------------MKTSN---------------------------- 256

  Fly   257 QQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQH 312
                           |.:.:|....:|||||:..|:...|:.||:::.|:.|||||
  Fly   257 ---------------LVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQH 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 33/76 (43%)
IGc2 55..125 CDD:197706 28/69 (41%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 37/95 (39%)
IG_like 98..179 CDD:214653 34/80 (43%)
IG_like 206..278 CDD:214653 22/136 (16%)
Ig 211..278 CDD:143165 21/131 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.