DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and Ama

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:288 Identity:61/288 - (21%)
Similarity:102/288 - (35%) Gaps:56/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VIAQKGGLAILPCVVKVNSPATVSWIRR-KDFQLLTVGLSTHS----SDKRFLVEHTR----HMG 105
            |:|..|......|.|:.....:|||.:| .:....:|.||..:    .|:|:.|..|.    ...
  Fly    42 VVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSA 106

  Fly   106 HWSLRIKAVREEDRGFYECQLSIYPTQSIV----IELKIVEAVAEISSAPELHIDETSTLRLECK 166
            .::.||:.:...|.|.||||:.:..|:.:.    :::|....:||.:....| :.|...|.|.| 
  Fly   107 IYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTL-VTEGQNLELTC- 169

  Fly   167 LKRATENP-AFVFWYHDSKMI-------------------NYDSQGGFVVTSIGQSNPQSGQF-- 209
              .|...| ..:.|..:...:                   ..|..|.:.:...|:..|.....  
  Fly   170 --HANGFPKPTISWAREHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRV 232

  Fly   210 ---YRSSPANKSRATMPMESSNGVLN-SLLGSSDAIKAPAANV---PSSTPYMTQQH----QSAY 263
               :|...|.:......|.|.:..|. |:.|      .||..|   .:..|..:.:|    .:|.
  Fly   233 EVEFRPQIAVQRPKIAQMVSHSAELECSVQG------YPAPTVVWHKNGVPLQSSRHHEVANTAS 291

  Fly   264 LLNPSVSVLTVKQVNFRHAGNYTCAPSN 291
            ....:.|||.:..|.....|:|.|..:|
  Fly   292 SSGTTTSVLRIDSVGEEDFGDYYCNATN 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 24/85 (28%)
IGc2 55..125 CDD:197706 20/78 (26%)
AmaNP_731114.2 I-set 33..143 CDD:254352 25/100 (25%)
Ig 37..127 CDD:299845 23/84 (27%)
IG_like 154..234 CDD:214653 12/83 (14%)
IGc2 161..223 CDD:197706 10/64 (16%)
I-set 254..330 CDD:254352 17/72 (24%)
IGc2 254..322 CDD:197706 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.