DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and dpr11

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:298 Identity:75/298 - (25%)
Similarity:133/298 - (44%) Gaps:64/298 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSTFSDVGKIT------SSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIR 76
            ::.||.:.:::      |:.:.....::...:....:.|..|.|..|.|||.||.....:|||||
  Fly    89 ATAFSSLAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIR 153

  Fly    77 RKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIELKIV 141
            .:|..:|||..:...:|:|||....... :|:|:||.|:..|.|.||||:|..|..|..::|::|
  Fly   154 LRDGHILTVDRAVFIADQRFLAIKQPDK-YWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVV 217

  Fly   142 EAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQGGFVVTSIGQSNPQS 206
            ....||...|:.::...|.:.|.|.::.|.|.|.|:.|||.::.:..||:               
  Fly   218 VPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSR--------------- 267

  Fly   207 GQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSVSV 271
                    .::::....:..::|...|.:||                                  
  Fly   268 --------RHRTQLDPNLPEASGEGQSTIGS---------------------------------- 290

  Fly   272 LTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAA 309
            |.::....|..|||||:|||:..|::|::::.||.:|:
  Fly   291 LIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSAS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 33/76 (43%)
IGc2 55..125 CDD:197706 29/69 (42%)
dpr11NP_001262320.1 I-set 125..216 CDD:254352 37/91 (41%)
Ig 127..217 CDD:299845 37/90 (41%)
IG_like 227..320 CDD:214653 29/149 (19%)
IGc2 234..311 CDD:197706 25/133 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.