DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and LSAMP

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:350 Identity:84/350 - (24%)
Similarity:143/350 - (40%) Gaps:59/350 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGH 106
            || :....:..::|..|||.|||: :..:.|:|:.|..  ::..|....|.|.|..:| .||...
Human    34 FN-RGTDNITVRQGDTAILRCVVE-DKNSKVAWLNRSG--IIFAGHDKWSLDPRVELE-KRHSLE 93

  Fly   107 WSLRIKAVREEDRGFYECQLSIY---PTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLK 168
            :||||:.|...|.|.|.|.:...   .|..:.:.:::...::.|||  ::.::|.|.:.|.|...
Human    94 YSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISS--DVTVNEGSNVTLVCMAN 156

  Fly   169 RATENPAFVFWYHDSKM-INYDSQGGFVVTSIGQSNPQSGQFYRSSPANK-SRATMPM------- 224
            ...|  ..:.|.|.:.. ..::.:..: :..:|.:..|||: |....||: |.|.:..       
Human   157 GRPE--PVITWRHLTPTGREFEGEEEY-LEILGITREQSGK-YECKAANEVSSADVKQVKVTVNY 217

  Fly   225 ----------ESSNGVLNSLLGSSDAIKAP---------AANVPSSTPYMTQQHQSAYLLNPSVS 270
                      |::.|...||...:.|:.||         ..|..:.....:.:.||:        
Human   218 PPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSS-------- 274

  Fly   271 VLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSILDT---ETNGNGTFGLIT 332
             |||..|...|.|||||..:|....:....||.......:.|..:.|..|   :..|.|     :
Human   275 -LTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTIPHPIQEIGTTVHFKQKGPG-----S 333

  Fly   333 LGGLNGTSGVTLAGGILYFSGLFLL 357
            :.|:||:..:.:...:|..|.|.||
Human   334 VRGINGSISLAVPLWLLAASLLCLL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 26/76 (34%)
IGc2 55..125 CDD:197706 25/69 (36%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 27/93 (29%)
Ig 132..215 CDD:386229 19/88 (22%)
Ig_3 219..294 CDD:372822 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.