DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and CG7166

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:325 Identity:72/325 - (22%)
Similarity:132/325 - (40%) Gaps:65/325 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRWHLHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNT-RVIAQKGGLAILPCVVKVN 67
            |.|.|    .|.|.|.:.|.:|.......:...|...:|.::.:. :||.  |....|||.|:..
  Fly     7 KYWTL----VLYLFSFSLSLIGGSFILPENDPPTTAPKFLSRGHLYKVIV--GETIELPCKVQNL 65

  Fly    68 SPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQ 132
            ....:.|  ||...:||.|....:.|:||.:     :|.::|:|..|:.:|.|.|.|||.....:
  Fly    66 GSFVLLW--RKGSSVLTAGHLKITRDQRFKI-----VGDYNLQINGVKTQDAGDYICQLGDQENR 123

  Fly   133 SIV--IELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPA-FVFWYHD---SKMINYDSQ 191
            ..|  :|:.:...:..:....::...:.||:.||||   |:.||. .:||:..   |...:....
  Fly   124 DQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECK---ASGNPVPTIFWFKKDVFSGPTHLSDS 185

  Fly   192 GGFVVTSIGQSNPQSGQFYRSSPAN--KSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPY 254
            ...::.::.:.:..:   |:.|..|  |.|.:|.::.:       :.|...|....:.|.:|..|
  Fly   186 STLILENVDRHHAGT---YQCSADNGVKDRVSMDIQLT-------ILSPPEITVEKSWVHASEGY 240

  Fly   255 MTQ--------------QHQSAYLLNP-------------SVSVLTVKQVNFRHAGNYTCAPSNA 292
            ..:              .:|:::||:.             |:.:...:..:|   |||:|...||
  Fly   241 DVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYSLIIRNFQPTDF---GNYSCVADNA 302

  Fly   293  292
              Fly   303  302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 25/76 (33%)
IGc2 55..125 CDD:197706 21/69 (30%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 28/91 (31%)
Ig 56..116 CDD:143165 20/66 (30%)
IG_like 144..221 CDD:214653 18/89 (20%)
IGc2 151..209 CDD:197706 15/63 (24%)
IG_like 232..313 CDD:214653 14/74 (19%)
Ig 242..311 CDD:143165 11/64 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.