DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and CG7166

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_649339.2 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:325 Identity:72/325 - (22%)
Similarity:132/325 - (40%) Gaps:65/325 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRWHLHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNT-RVIAQKGGLAILPCVVKVN 67
            |.|.|    .|.|.|.:.|.:|.......:...|...:|.::.:. :||.  |....|||.|:..
  Fly     7 KYWTL----VLYLFSFSLSLIGGSFILPENDPPTTAPKFLSRGHLYKVIV--GETIELPCKVQNL 65

  Fly    68 SPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQ 132
            ....:.|  ||...:||.|....:.|:||.:     :|.::|:|..|:.:|.|.|.|||.....:
  Fly    66 GSFVLLW--RKGSSVLTAGHLKITRDQRFKI-----VGDYNLQINGVKTQDAGDYICQLGDQENR 123

  Fly   133 SIV--IELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPA-FVFWYHD---SKMINYDSQ 191
            ..|  :|:.:...:..:....::...:.||:.||||   |:.||. .:||:..   |...:....
  Fly   124 DQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECK---ASGNPVPTIFWFKKDVFSGPTHLSDS 185

  Fly   192 GGFVVTSIGQSNPQSGQFYRSSPAN--KSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPY 254
            ...::.::.:.:..:   |:.|..|  |.|.:|.::.:       :.|...|....:.|.:|..|
  Fly   186 STLILENVDRHHAGT---YQCSADNGVKDRVSMDIQLT-------ILSPPEITVEKSWVHASEGY 240

  Fly   255 MTQ--------------QHQSAYLLNP-------------SVSVLTVKQVNFRHAGNYTCAPSNA 292
            ..:              .:|:::||:.             |:.:...:..:|   |||:|...||
  Fly   241 DVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYSLIIRNFQPTDF---GNYSCVADNA 302

  Fly   293  292
              Fly   303  302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 25/76 (33%)
Ig strand B 58..62 CDD:409353 1/3 (33%)
Ig strand C 71..75 CDD:409353 0/3 (0%)
Ig strand E 107..111 CDD:409353 1/3 (33%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250 9/41 (22%)
Ig strand E 270..274 CDD:409551 0/3 (0%)
Ig strand F 284..289 CDD:409551 3/4 (75%)
CG7166NP_649339.2 IG_like 50..133 CDD:214653 28/91 (31%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 1/5 (20%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..116 CDD:409353 1/3 (33%)
Ig_3 134..207 CDD:464046 14/78 (18%)
Ig_3 224..301 CDD:464046 13/79 (16%)

Return to query results.
Submit another query.