| Sequence 1: | NP_001260336.1 | Gene: | dpr19 / 34408 | FlyBaseID: | FBgn0032233 | Length: | 385 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001094842.1 | Gene: | IGLON5 / 402665 | HGNCID: | 34550 | Length: | 336 | Species: | Homo sapiens |
| Alignment Length: | 296 | Identity: | 73/296 - (24%) |
|---|---|---|---|
| Similarity: | 118/296 - (39%) | Gaps: | 54/296 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 41 QFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRF-LVEHTRHM 104
Fly 105 GHWSLRIKAVREEDRGFYECQLSI----YPTQSIVIELKIVEAVAEISSAPELHIDETSTLRLEC 165
Fly 166 KLKRATENPAFVFW--YHDSKMINYDSQGGFVVTSIGQSNPQSGQF-------YRSSPANKSRAT 221
Fly 222 M------PMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSV----------- 269
Fly 270 -SVLTVKQVNFRHAGNYTCAPSNARPA-SITVHVLR 303 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr19 | NP_001260336.1 | IG_like | 50..127 | CDD:214653 | 21/77 (27%) |
| IGc2 | 55..125 | CDD:197706 | 20/70 (29%) | ||
| IGLON5 | NP_001094842.1 | Ig | 41..129 | CDD:416386 | 25/94 (27%) |
| Ig strand A' | 41..46 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 48..56 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 56..60 | CDD:409353 | 0/4 (0%) | ||
| FR2 | 61..68 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 61..67 | CDD:409353 | 2/5 (40%) | ||
| CDR2 | 69..79 | CDD:409353 | 2/11 (18%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 1/2 (50%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 80..115 | CDD:409353 | 12/36 (33%) | ||
| Ig strand D | 84..91 | CDD:409353 | 2/6 (33%) | ||
| Ig strand E | 94..100 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 116..120 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 120..129 | CDD:409353 | 4/9 (44%) | ||
| FR4 | 122..129 | CDD:409353 | 3/7 (43%) | ||
| Ig_3 | 134..199 | CDD:404760 | 17/73 (23%) | ||
| Ig strand B | 148..157 | CDD:409353 | 3/9 (33%) | ||
| Ig strand C | 162..170 | CDD:409353 | 3/8 (38%) | ||
| Ig strand F | 191..199 | CDD:409353 | 1/7 (14%) | ||
| Ig strand G | 202..212 | CDD:409353 | 4/11 (36%) | ||
| Ig_3 | 217..295 | CDD:404760 | 20/80 (25%) | ||
| putative Ig strand A | 218..224 | CDD:409353 | 1/5 (20%) | ||
| Ig strand B | 234..238 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 247..251 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 288..293 | CDD:409353 | 4/4 (100%) | ||
| Ig strand G | 301..304 | CDD:409353 | 1/2 (50%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||