DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and dpr13

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:281 Identity:98/281 - (34%)
Similarity:140/281 - (49%) Gaps:67/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLV 98
            ||..:  .|.|:|:|.|..|.|..|.:||.|.......|||||:||:.||||||:|:|||:||..
  Fly   171 FGTPM--YFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSA 233

  Fly    99 EHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIELKIVEAVAEISSAPELHIDETSTLRL 163
            .|.:|...|:|:||.|:..|.|.||||:|.:|..||.:.|.:|||.|||:..|..::...|||||
  Fly   234 THLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPIRYLTPGSTLRL 298

  Fly   164 ECKLKRATENPAFVFWYHDSKMINYDSQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSN 228
            :|::.:.||...::|||||::|||||...|.                                  
  Fly   299 QCRVVQNTEASEYIFWYHDNRMINYDIDRGI---------------------------------- 329

  Fly   229 GVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNAR 293
                              ||.:...:.:             |.||:::....|:||:||..||.:
  Fly   330 ------------------NVSTEPDFQS-------------SELTIQRTRREHSGNFTCVASNTQ 363

  Fly   294 PASITVHVLRGEKTAAMQHAN 314
            |||:.||:.:|:..|||.|.:
  Fly   364 PASVLVHIFKGDNPAAMYHGH 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 39/76 (51%)
IGc2 55..125 CDD:197706 35/69 (51%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 46/95 (48%)
IG_like 182..262 CDD:214653 40/79 (51%)
IG_like 285..362 CDD:214653 31/141 (22%)
IGc2 292..361 CDD:197706 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11088
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100772at6656
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
87.970

Return to query results.
Submit another query.