DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and ImpL2

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:136 Identity:31/136 - (22%)
Similarity:56/136 - (41%) Gaps:36/136 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HLSCFLLLLSSTFSDVGKITSSQNHFGNTL----QSQFNTKNNTRVIAQK--------------G 55
            |:...:|..:.|::.||: |.|:..:.:|:    :|...|...|...|||              |
  Fly   125 HIIDHVLSEARTYTCVGR-TGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMG 188

  Fly    56 GLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRH--MGHWSLRIKAVREED 118
            ....|||.|.....|.::|:               :::.:.:|:..||  :.:..|.|..::.||
  Fly   189 SNIQLPCRVHARPRAEITWL---------------NNENKEIVQGHRHRVLANGDLLISEIKWED 238

  Fly   119 RGFYEC 124
            .|.|:|
  Fly   239 MGNYKC 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 20/91 (22%)
IGc2 55..125 CDD:197706 17/72 (24%)
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 17/73 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.