DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and Lac

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:325 Identity:64/325 - (19%)
Similarity:111/325 - (34%) Gaps:76/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GGLAILPCVVKVNSPATVSWIRR-KDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREED 118
            ||.....|.|:......|.:::. .|...|:.|.:....|.||.:.:..:...:.|:||.::|.|
  Fly    43 GGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETD 107

  Fly   119 RGFYECQLSIYPTQSIVIELKIV---EAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWY 180
            .|.|.||:.|.....:..|:|:.   ..|...:|...:...|.|.:::|| .......|...:..
  Fly   108 AGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMEC-YASGYPTPTITWRR 171

  Fly   181 HDSKMINYDSQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGV-------LNSLLGSS 238
            .::.::..||     .|.:|.:      ....|...:.|.|....:.|||       :|..:..:
  Fly   172 ENNAILPTDS-----ATYVGNT------LRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFA 225

  Fly   239 DAIKAPAANVPSSTPY-------------------------MTQQHQSA-------YLLNPSVSV 271
            ..|..|...:..:..|                         ...||.|.       ...:.::.|
  Fly   226 PVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRV 290

  Fly   272 LTVKQVNFRHAGNYTCAPSN------AR------------PASITVHVLRGEKTAAMQHANRSIL 318
            :||::   |..|:|.|..:|      ||            ||....::...|..:|...|...||
  Fly   291 ITVEK---RQYGDYVCKATNRFGEAEARVNLFETIIPVCPPACGQAYIAGAEDVSATSFALVGIL 352

  Fly   319  318
              Fly   353  352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 20/72 (28%)
Ig strand B 58..62 CDD:409353 0/3 (0%)
Ig strand C 71..75 CDD:409353 1/3 (33%)
Ig strand E 107..111 CDD:409353 1/3 (33%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250 12/50 (24%)
Ig strand E 270..274 CDD:409551 1/3 (33%)
Ig strand F 284..289 CDD:409551 2/4 (50%)
LacNP_523713.2 IG_like 36..131 CDD:214653 23/87 (26%)
Ig strand B 46..50 CDD:409381 0/3 (0%)
Ig strand C 60..63 CDD:409381 1/2 (50%)
Ig strand E 96..100 CDD:409381 1/3 (33%)
Ig strand F 110..115 CDD:409381 2/4 (50%)
Ig strand G 124..127 CDD:409381 0/2 (0%)
Ig_3 134..208 CDD:464046 14/85 (16%)
Ig 227..318 CDD:472250 16/93 (17%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 0/3 (0%)
Ig strand F 300..305 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.