Sequence 1: | NP_001260336.1 | Gene: | dpr19 / 34408 | FlyBaseID: | FBgn0032233 | Length: | 385 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_940908.3 | Gene: | LRIT3 / 345193 | HGNCID: | 24783 | Length: | 679 | Species: | Homo sapiens |
Alignment Length: | 262 | Identity: | 55/262 - (20%) |
---|---|---|---|
Similarity: | 98/262 - (37%) | Gaps: | 56/262 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 NSPATVSWIRRKDFQLL-TVGLSTH--SSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSI 128
Fly 129 YPTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWY---HDSKMINYDS 190
Fly 191 QGGFVVTSIGQ----SNPQ--SGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVP 249
Fly 250 SSTPYMTQQHQSAYLLNPSV-----------SVLTVKQVNFRHAGNYTCAPSN---ARPASITVH 300
Fly 301 VL 302 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr19 | NP_001260336.1 | IG_like | 50..127 | CDD:214653 | 13/62 (21%) |
IGc2 | 55..125 | CDD:197706 | 13/60 (22%) | ||
LRIT3 | NP_940908.3 | LRR 1 | 56..79 | ||
leucine-rich repeat | 59..82 | CDD:275378 | |||
LRR_8 | 61..117 | CDD:290566 | 1/1 (100%) | ||
LRR 2 | 80..103 | ||||
leucine-rich repeat | 83..106 | CDD:275378 | |||
LRR 3 | 104..128 | 4/12 (33%) | |||
LRR_8 | 105..165 | CDD:290566 | 11/49 (22%) | ||
LRR_4 | 105..146 | CDD:289563 | 10/30 (33%) | ||
leucine-rich repeat | 107..130 | CDD:275378 | 5/14 (36%) | ||
LRR 4 | 129..151 | 5/21 (24%) | |||
LRR_4 | 131..170 | CDD:289563 | 5/38 (13%) | ||
leucine-rich repeat | 131..154 | CDD:275378 | 4/22 (18%) | ||
LRR 5 | 152..175 | 2/22 (9%) | |||
leucine-rich repeat | 155..168 | CDD:275378 | 1/12 (8%) | ||
Ig | 267..345 | CDD:299845 | 19/79 (24%) | ||
IG_like | 267..345 | CDD:214653 | 19/79 (24%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 351..375 | ||||
FN3 | 486..550 | CDD:214495 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |