DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and DIP-eta

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_608946.3 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:393 Identity:80/393 - (20%)
Similarity:153/393 - (38%) Gaps:91/393 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 AQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVRE 116
            |..|..|.|.|||:...|..|:|:|.....:||:.....:.::|..:.::.|. .|::|||.::|
  Fly    54 APVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEHK-TWTMRIKDIKE 117

  Fly   117 EDRGFYECQLSIYPTQSIV--IELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENP-AFVF 178
            .|:|:|.||::..|.:|.:  :::.:...:.:..::.::.:.|.|.:.|:|   .||.:| ..:.
  Fly   118 SDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKC---AATGSPEPTIT 179

  Fly   179 WYHDSKMINYDSQGGFVVTSIGQSN---PQSGQFYRSS----------PANKSRATM-----PME 225
            |..:|. :..:...|..|.||..::   |...:.:..:          |:...|.|:     ||.
  Fly   180 WRRESG-VPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMI 243

  Fly   226 S-SNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQ----------------SAYLLNPSVSVLT 273
            : .|.::.::.|....:...:...|.|..|.|::..                ..|..:..:.:..
  Fly   244 TVQNQLIGAVEGKGVTLDCESEAYPKSINYWTRERGEIVPPGGKYSANVTEIGGYRNSMRLHINP 308

  Fly   274 VKQVNFRHAGNYTCAPSNAR------------PASITVHV------LRGEK----------TAAM 310
            :.|..|   |:|.|...|:.            |.:...:|      .:|:|          ..|.
  Fly   309 LTQAEF---GSYRCVAKNSLGDTDGTIKLYRIPPNAVNYVENFEARHKGKKRTKSSESHHPARAQ 370

  Fly   311 QHANRSILDTETNGNG----TFGLITLGGLNGTSGVTL-----AGGILYFSGLFLLMGAVVFDRF 366
            :|:..   |.|..|..    :.|..::..:.|.|....     .||:     |.||:...|....
  Fly   371 EHSGE---DMENPGKRKADLSLGAESIDSIYGNSAAGSRRRQDLGGV-----LLLLLPVAVAVAM 427

  Fly   367 SLA 369
            |||
  Fly   428 SLA 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 25/74 (34%)
Ig strand B 58..62 CDD:409353 2/3 (67%)
Ig strand C 71..75 CDD:409353 1/3 (33%)
Ig strand E 107..111 CDD:409353 1/3 (33%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250 7/44 (16%)
Ig strand E 270..274 CDD:409551 0/3 (0%)
Ig strand F 284..289 CDD:409551 2/4 (50%)
DIP-etaNP_608946.3 IG_like 51..137 CDD:214653 27/83 (33%)
Ig strand B 60..64 CDD:409353 2/3 (67%)
Ig strand C 73..77 CDD:409353 1/3 (33%)
Ig strand E 108..112 CDD:409353 1/3 (33%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
IgI_1_MuSK 145..237 CDD:409562 17/95 (18%)
Ig strand A 145..148 CDD:409562 0/2 (0%)
Ig strand A' 153..158 CDD:409562 0/4 (0%)
Ig strand B 164..171 CDD:409562 2/9 (22%)
Ig strand C 177..182 CDD:409562 1/4 (25%)
Ig strand C' 184..186 CDD:409562 1/2 (50%)
Ig strand D 194..197 CDD:409562 0/2 (0%)
Ig strand E 202..208 CDD:409562 0/5 (0%)
Ig strand F 215..222 CDD:409562 0/6 (0%)
Ig strand G 229..237 CDD:409562 2/7 (29%)
IG_like 252..335 CDD:214653 12/85 (14%)
Ig strand B 258..262 CDD:409353 0/3 (0%)
Ig strand C 271..282 CDD:409353 2/10 (20%)
Ig strand E 301..306 CDD:409353 0/4 (0%)
Ig strand F 316..321 CDD:409353 2/4 (50%)
Ig strand G 329..332 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.