DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and DIP-eta

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:393 Identity:80/393 - (20%)
Similarity:153/393 - (38%) Gaps:91/393 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 AQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVRE 116
            |..|..|.|.|||:...|..|:|:|.....:||:.....:.::|..:.::.|. .|::|||.::|
  Fly    54 APVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEHK-TWTMRIKDIKE 117

  Fly   117 EDRGFYECQLSIYPTQSIV--IELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENP-AFVF 178
            .|:|:|.||::..|.:|.:  :::.:...:.:..::.::.:.|.|.:.|:|   .||.:| ..:.
  Fly   118 SDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKC---AATGSPEPTIT 179

  Fly   179 WYHDSKMINYDSQGGFVVTSIGQSN---PQSGQFYRSS----------PANKSRATM-----PME 225
            |..:|. :..:...|..|.||..::   |...:.:..:          |:...|.|:     ||.
  Fly   180 WRRESG-VPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMI 243

  Fly   226 S-SNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQ----------------SAYLLNPSVSVLT 273
            : .|.::.::.|....:...:...|.|..|.|::..                ..|..:..:.:..
  Fly   244 TVQNQLIGAVEGKGVTLDCESEAYPKSINYWTRERGEIVPPGGKYSANVTEIGGYRNSMRLHINP 308

  Fly   274 VKQVNFRHAGNYTCAPSNAR------------PASITVHV------LRGEK----------TAAM 310
            :.|..|   |:|.|...|:.            |.:...:|      .:|:|          ..|.
  Fly   309 LTQAEF---GSYRCVAKNSLGDTDGTIKLYRIPPNAVNYVENFEARHKGKKRTKSSESHHPARAQ 370

  Fly   311 QHANRSILDTETNGNG----TFGLITLGGLNGTSGVTL-----AGGILYFSGLFLLMGAVVFDRF 366
            :|:..   |.|..|..    :.|..::..:.|.|....     .||:     |.||:...|....
  Fly   371 EHSGE---DMENPGKRKADLSLGAESIDSIYGNSAAGSRRRQDLGGV-----LLLLLPVAVAVAM 427

  Fly   367 SLA 369
            |||
  Fly   428 SLA 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 25/74 (34%)
IGc2 55..125 CDD:197706 22/69 (32%)
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 27/87 (31%)
IG_like 51..137 CDD:214653 27/83 (33%)
IG_like 153..237 CDD:214653 17/87 (20%)
Ig 161..224 CDD:299845 13/66 (20%)
IG_like 252..335 CDD:214653 12/85 (14%)
Ig 258..333 CDD:143165 11/77 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.