DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and fipi

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:251 Identity:56/251 - (22%)
Similarity:87/251 - (34%) Gaps:54/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWS 108
            |:|.|.:..::|..|.:.|.||......|:|  ..:.|.::.| :...|..|.|.:        .
  Fly   122 TENATVMTVKEGEKATILCEVKGEPQPNVTW--HFNGQPISAG-AADDSKFRILAD--------G 175

  Fly   109 LRIKAVREEDRGFYECQLSIYPTQSIV-----------IELKIVEAVAEISSAPELHIDETSTLR 162
            |.|..|.:.|.|.|.|:  .|...||.           ||.|.:.:.....|....:|:.|:||.
  Fly   176 LLINKVTQNDTGEYACR--AYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLM 238

  Fly   163 LECKLKRATENPAFVFWYH-------DSKMINYDSQGGFVVTSIGQSNPQSGQFYRSSPANK--- 217
            .|.    ..|.||...||.       ::::....|...:...:|...|..:...||....|.   
  Fly   239 CEA----LAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGT 299

  Fly   218 -SRAT------MPMESSNGVLNSLLGSSDAIKAPAANVPSSTP---------YMTQ 257
             .|.|      .|...:|..|.....::..:...|...|..:|         |||:
  Fly   300 IERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRGPPDSPMGVNGFRIEYMTE 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 19/76 (25%)
IGc2 55..125 CDD:197706 18/69 (26%)
fipiNP_787975.1 IG_like 33..115 CDD:214653
I-set 128..202 CDD:254352 22/86 (26%)
Ig 133..>193 CDD:299845 19/72 (26%)
IG_like 228..307 CDD:214653 18/82 (22%)
Ig 235..305 CDD:143165 15/73 (21%)
FN3 312..415 CDD:238020 9/44 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.