DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and itgb4

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_005166847.1 Gene:itgb4 / 335269 ZFINID:ZDB-GENE-030131-7209 Length:1931 Species:Danio rerio


Alignment Length:290 Identity:66/290 - (22%)
Similarity:106/290 - (36%) Gaps:79/290 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGL-AILPCVVKVNSPATVSWIRRKDFQLL 83
            :|.:|.|:||:...|...||.:..:.|   :.|.:||. |||...|..:.   :.|  |||    
Zfish   200 SFRNVIKLTSNITSFRQKLQKERISGN---LDAPEGGFDAILQTAVCQDQ---IGW--RKD---- 252

  Fly    84 TVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREE--DRGFYECQLSI-----------YPTQSIV 135
                |||     .||..|....|:......|...  ||...:|.|::           ||:...:
Zfish   253 ----STH-----LLVFSTESAFHYEADGANVLAGILDRNDEQCHLNVDGNYTHDVRQDYPSIPTL 308

  Fly   136 IELKI------VEAVAE--------------ISSAPELHIDETSTLRLECKLKRATENPAFVFWY 180
            :.|.:      :.||..              |:...:|..|.::.|.:   |::|.||..     
Zfish   309 VRLLVKHNIIPIFAVTNHSYSYYEKLHEYFPIAELGQLQEDSSNILSI---LEKAFENIR----- 365

  Fly   181 HDSKM-INYDSQGGFVVTSIGQSNPQSGQF-----YRSSPANKSRATMPMESSNGVLNSLLGSSD 239
              ||: |..:.:...|.|.|..   |||.|     ::.:|....:..:.|::.|.|     |...
Zfish   366 --SKISIRAEDRPKAVETKIFS---QSGTFSEYGNFKITPGQTGKFKVRMKALNQV-----GEEP 420

  Fly   240 AIKAPAANVPSSTPYMTQQHQSAYLLNPSV 269
            ..|...|:...:.........||:.:|..|
Zfish   421 VCKVNQADRAGTLRVKPTTFSSAFKINAEV 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 22/79 (28%)
IGc2 55..125 CDD:197706 20/72 (28%)
itgb4XP_005166847.1 Integrin_beta 37..457 CDD:278776 66/290 (23%)
EGF_2 <468..490 CDD:285248
EGF_2 545..573 CDD:285248
Integrin_B_tail 625..709 CDD:285239
Calx-beta 991..1064 CDD:295344
FN3 1242..1326 CDD:238020
FN3 1331..1420 CDD:238020
fn3 1640..1720 CDD:278470
fn3 1751..1835 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.