DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and CG33543

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:380 Identity:85/380 - (22%)
Similarity:135/380 - (35%) Gaps:84/380 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSW 74
            |:.|.||::...|           ||.|.|.|         ..::|..|::.|.|:......|||
  Fly   141 LASFELLVNQKIS-----------FGKTEQVQ---------SVREGRDAMVNCFVEGMPAPEVSW 185

  Fly    75 IRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQ-LSIYPTQSIVIEL 138
            :...::      ::|.:|.|     |.|...  .|.|:.|.:.|.|.|.|: :.|.||.|...::
  Fly   186 LYNGEY------INTVNSTK-----HNRLSN--GLYIRNVSQADAGEYTCRAMRITPTFSDSDQI 237

  Fly   139 KIVEAVAEISSAPELHIDET---------STLRLECKLKRATENPAFVFWYHDSKMINYDSQGGF 194
            .|   :..|...|....:||         ..:.|.|  ....|.|....|.|::|.|...:...|
  Fly   238 TI---LLRIQHKPHWFFNETLPVQYAYVGGAVNLSC--DAMGEPPPSFTWLHNNKGIVGFNHRIF 297

  Fly   195 VV---TSIGQSNPQSGQF--YRSSPANKSRATMPMESSNGVLNSLLGSSD------AIKAPAAN- 247
            |.   .::......:.||  |:...||      |:.....|:....|...      .:|....| 
  Fly   298 VADYGATLQLQMKNASQFGDYKCKVAN------PLGMLERVIKLRPGPKPLGPRRFQLKKLYTNG 356

  Fly   248 --VPSSTPYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAM 310
              :...||.|:.......:....|:.::..:..| .|||:    |.|:....:.|   |.|...:
  Fly   357 FELDIQTPRMSNVSDEMQIYGYRVAYMSDTEFKF-SAGNW----SYAKQRDFSFH---GGKHFII 413

  Fly   311 QHANRSILDTETNGNGTFGLITLGGLNGTSGV---TLAGGILYFSGLFLLMGAVV 362
            .|     |:|.|..........|.||:..|.|   |.|.|..:...|:...|.::
  Fly   414 PH-----LETNTTYLMRAASRNLAGLSDWSPVKVFTTAAGCSWSPWLYPSYGLIL 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 19/77 (25%)
IGc2 55..125 CDD:197706 18/69 (26%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 19/71 (27%)
IG_like 256..336 CDD:214653 17/87 (20%)
IGc2 263..327 CDD:197706 16/71 (23%)
FN3 341..445 CDD:238020 24/116 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.