DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and dpr4

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:309 Identity:93/309 - (30%)
Similarity:137/309 - (44%) Gaps:70/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CFLLLLSSTFSDVGKITSS-QNHFGNTLQSQ--FNTKNNTRVIAQKGGLAILPCVVKVNSPATVS 73
            |.:.|....|.|.|.:... ..|:..|..||  |:..:...|.|..|..|:|.|.|:......||
  Fly    14 CLVPLWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVS 78

  Fly    74 WIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIEL 138
            |||::|..:||||:.|:::|:||...|:.....|:|||.:.:..|.|.||||:|..|..|....|
  Fly    79 WIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRL 143

  Fly   139 KIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQGGF-VVTSIGQS 202
            .:|.:.|:|....||.|...|.:.|.|...::...|:|::||...:::||..:||. |:|.    
  Fly   144 NVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITE---- 204

  Fly   203 NPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNP 267
                    ||:..:|                ||            :..:||              
  Fly   205 --------RSTRTSK----------------LL------------IAKATP-------------- 219

  Fly   268 SVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRS 316
                        ..:|||||:||::..||:.|||:.||..|||||.|.|
  Fly   220 ------------ADSGNYTCSPSSSDSASVVVHVINGEHPAAMQHGNSS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 32/76 (42%)
Ig strand B 58..62 CDD:409353 2/3 (67%)
Ig strand C 71..75 CDD:409353 2/3 (67%)
Ig strand E 107..111 CDD:409353 2/3 (67%)
Ig strand F 121..126 CDD:409353 3/4 (75%)
Ig <265..298 CDD:472250 9/32 (28%)
Ig strand E 270..274 CDD:409551 0/3 (0%)
Ig strand F 284..289 CDD:409551 4/4 (100%)
dpr4NP_001014616.2 IG_like 53..145 CDD:214653 36/91 (40%)
Ig strand A' 55..57 CDD:409355 1/1 (100%)
Ig strand B 61..69 CDD:409355 3/7 (43%)
CDR1 69..75 CDD:409355 1/5 (20%)
Ig strand C 76..82 CDD:409355 4/5 (80%)
CDR2 85..101 CDD:409355 6/15 (40%)
Ig strand D 101..106 CDD:409355 1/4 (25%)
FR3 102..131 CDD:409355 10/28 (36%)
Ig strand E 110..117 CDD:409355 3/6 (50%)
Ig strand F 125..132 CDD:409355 5/6 (83%)
IG_like 161..>227 CDD:214653 23/131 (18%)
Ig strand B 166..170 CDD:409353 1/3 (33%)
Ig strand C 181..185 CDD:409353 1/3 (33%)
Ig strand E 206..214 CDD:409353 4/35 (11%)

Return to query results.
Submit another query.