DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and DIP-beta

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:459 Identity:99/459 - (21%)
Similarity:157/459 - (34%) Gaps:144/459 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWHLHL-----SCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVV 64
            ||.|.|     :|..|.:|:..|.||           ..:..|........||| |..|...|||
  Fly    69 RWQLLLLLLLGNCIDLTVSNKISSVG-----------AFEPDFVIPLENVTIAQ-GRDATFTCVV 121

  Fly    65 K-----------VNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREED 118
            .           .::||.|:||:.....:|.:.....:::.|..|:|..: ..|:|.|:.|:.||
  Fly   122 NNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDY-NTWTLNIRGVKMED 185

  Fly   119 RGFYECQLSIYPTQSIVIELKIVEAVAEISSAPELHIDETS---------TLRLECKLKRATENP 174
            .|.|.||::..|       :|:..|..|:...|::..:|||         :.:|.|:.:.     
  Fly   186 AGKYMCQVNTDP-------MKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARG----- 238

  Fly   175 AFVFWYHDSKMINYDSQGGFVVTSIGQSNPQS------GQFYRSSPANKSRATMPM-ESSNG--- 229
                  |....|.:..:.|..:.:...|:.::      |:....|...:|.....| .:|||   
  Fly   239 ------HPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPP 297

  Fly   230 -----------------VLNSLLGSSDAIKAPA-------ANV---PSSTPY------------- 254
                             |.|.|:|      ||.       .||   |.:..|             
  Fly   298 TVSKRMKLQVHFHPLVQVPNQLVG------APVLTDVTLICNVEASPKAINYWQRENGEMIIAGD 356

  Fly   255 ---MTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNA--------------RPASITVHVL 302
               :|::..:.|.:.   .:|.:|::.....|.|.|...|:              ||..   .:|
  Fly   357 RYALTEKENNMYAIE---MILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEMERPGK---KIL 415

  Fly   303 RGE------KTAAMQHANRSILDTETNGNGTFGLITLGGLNGTSG--VTLAGGILYFSGLFLLMG 359
            |.:      |...:|...|| .|...|.||..........:..||  ..|..|.:...|.|||..
  Fly   416 RDDDLNEVSKNEVVQKDTRS-EDGSRNLNGRLYKDRAPDQHPASGSDQLLGRGTMRLIGTFLLAL 479

  Fly   360 AVVF 363
            .|:|
  Fly   480 LVLF 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653 27/87 (31%)
Ig strand B 58..62 CDD:409353 1/3 (33%)
Ig strand C 71..75 CDD:409353 1/3 (33%)
Ig strand E 107..111 CDD:409353 2/3 (67%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250 8/46 (17%)
Ig strand E 270..274 CDD:409551 1/3 (33%)
Ig strand F 284..289 CDD:409551 2/4 (50%)
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 32/119 (27%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 17/106 (16%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 0/3 (0%)
Ig strand F 286..291 CDD:409353 1/4 (25%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 12/80 (15%)
Ig strand B 328..332 CDD:409353 0/3 (0%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 2/13 (15%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.