DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and Opcml

DIOPT Version :10

Sequence 1:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_006510497.1 Gene:Opcml / 330908 MGIID:97397 Length:354 Species:Mus musculus


Alignment Length:424 Identity:80/424 - (18%)
Similarity:137/424 - (32%) Gaps:150/424 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 SNELTG-KGQALEQYAFGVMCEEILHNKTDANIPAVEDFK---AYCATHLKHGNPAMRPNLSAVL 243
            :.||.| :.|.|...|.|.:....:.|:.|.:|..|....   .||....|.|.|.:......||
Mouse    71 TEELRGHRLQRLAHLALGYITMAYVWNRGDDDIRKVLPRNLAVPYCELSEKLGLPPILSYADCVL 135

  Fly   244 LH--------PIFNHDFILIHSFLTELPLKGTQAKQEFFI-----------------SLADRLRS 283
            .:        |:...:..::.||      .|....:.||:                 :::..:..
Mouse   136 ANWKKKDPNGPMTYENMDILFSF------PGGDCDKGFFLVSLMVEIAASPAIKAIPTVSSAVEH 194

  Fly   284 FDPETVAEQMCSLLLSRIVLLDTTAQLCVTPYVLRPKSDDLSPGLFTPKIFSAYILPKVKQVFCV 348
            .||:.:.:.:||:..|                                       |.|.|::|  
Mouse   195 QDPKALEKALCSIAAS---------------------------------------LEKAKEIF-- 218

  Fly   349 QDAQIRLMLLEYFPAYVEFFTKEDLQDHILPQLLLGIKDTNDVLVAKTLLCLADLVPILGSAVVI 413
                          ..:..|...|...|:|...|.|.|..                |.|...::.
Mouse   219 --------------KRMRDFVDPDTFFHVLRIYLSGWKGN----------------PKLPEGLLY 253

  Fly   414 GG--NRSKIFADGRPQGIPDAAGPWSGVRSITPVIGSGEFLSGSPVPDAGGDNSASFTSVL---L 473
            .|  :..|.|:.|       :||..|..:|:..::|...        |.|..::|.|...:   :
Mouse   254 EGVWDTPKKFSGG-------SAGQSSIFQSLDVLLGIKH--------DVGEGSAAEFLQEMREYM 303

  Fly   474 RP--DNFNAMPERLSPEGEDIYRTNNSDVELEVDEWSDWENDGSEVVPVNHLRLIDTGAPEP--- 533
            .|  .||.:..|...|..|.:....|.|::   :.:::..| |...:.:.||.::||...:|   
Mouse   304 PPAHRNFLSSLESAPPVREFVILRRNEDLK---EAYNECVN-GLVSLRMFHLSIVDTYIVKPSKQ 364

  Fly   534 VPMNGVPEETILTPEPIAPFTTLSRESSTESKGS 567
            .||.|...|     ||          |:||::|:
Mouse   365 KPMGGHKSE-----EP----------SNTENRGT 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_609392.1 IG_like 50..127 CDD:214653
Ig strand B 58..62 CDD:409353
Ig strand C 71..75 CDD:409353
Ig strand E 107..111 CDD:409353
Ig strand F 121..126 CDD:409353
Ig <265..298 CDD:472250 7/49 (14%)
Ig strand E 270..274 CDD:409551 0/3 (0%)
Ig strand F 284..289 CDD:409551 2/4 (50%)
OpcmlXP_006510497.1 Ig 44..132 CDD:472250 16/60 (27%)
Ig strand B 53..57 CDD:409353
Ig strand C 65..69 CDD:409353
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..117 CDD:409353 1/4 (25%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig_3 135..206 CDD:464046 9/76 (12%)
Ig 224..312 CDD:472250 25/118 (21%)
Ig strand B 240..244 CDD:409353 2/3 (67%)
Ig strand C 253..257 CDD:409353 1/3 (33%)
Ig strand E 279..283 CDD:409353 0/3 (0%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.