DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and dpr18

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:328 Identity:77/328 - (23%)
Similarity:133/328 - (40%) Gaps:71/328 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TFSDVGKITS-------SQNHFGNTLQSQFNTKNNTRVIAQKGGL---AILPCVVKVNSPATVSW 74
            |.|...::|.       .::|:|...:...|:..:...:.....|   |:|.|.|.:....||.|
  Fly   194 TASGFARVTERPRSKHHHEHHWGPFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMW 258

  Fly    75 IRR--KDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIE 137
            :||  :...|||||..|:|.|.|..|:. ::..:|.|.|...:.||.|.|.||:|.:|.:.....
  Fly   259 VRRTAEKVSLLTVGNVTYSGDPRIRVKF-QYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTN 322

  Fly   138 LKIVEAVAEISSAPELHIDET-----STLRLECKLKRA--------------TENPAFVFWYHDS 183
            |.::|....|....|..:.:.     ||:.|:|::.|:              :.|.|.      .
  Fly   323 LTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAV------Q 381

  Fly   184 KMINYDSQGGFVVTSIGQSNPQ-SGQ---FYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAP 244
            |:||..:....::.::.|:..: |||   .|.:.....::...|::   |:.|..|..||.    
  Fly   382 KLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQ---GMTNRRLSVSDV---- 439

  Fly   245 AANVPSSTPYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAA 309
                     ::|             |.:::.......:|||:|:........:.|.||.||..||
  Fly   440 ---------WLT-------------SRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPAA 482

  Fly   310 MQH 312
            :||
  Fly   483 VQH 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 29/81 (36%)
IGc2 55..125 CDD:197706 27/74 (36%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 31/83 (37%)
Ig <258..326 CDD:299845 25/68 (37%)
IGc2 <417..461 CDD:197706 11/72 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.