DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and dpr8

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:331 Identity:103/331 - (31%)
Similarity:141/331 - (42%) Gaps:86/331 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WHLHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQS---------QFNTKNNTRVIAQKGGLAILP 61
            |.:.|....||...|..      :|:..|.:.||.         .|:|...|.:....|....|.
  Fly     5 WIIFLGILCLLAGCTDG------ASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLT 63

  Fly    62 CVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQL 126
            |.||.....||||:|.:|..|||||..|::||:||...|:.|...|:|||:..:.:|.|.||||:
  Fly    64 CRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQI 128

  Fly   127 SIYPTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQ 191
            |..|.....:.|.|||.|.:|...|||||:..||:.|.|.:|.|.|.|..|.|.|:.::||:|| 
  Fly   129 STTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDS- 192

  Fly   192 GGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMT 256
                        |:.|              :.:.:..|||                         
  Fly   193 ------------PRGG--------------ISLVTEKGVL------------------------- 206

  Fly   257 QQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSILDTE 321
                       :.|.|.|::...:.:|.|||.||||.|.|:.||::.||..|||...|       
  Fly   207 -----------TTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHIVDGEHPAAMHTGN------- 253

  Fly   322 TNGNGT 327
             |||.|
  Fly   254 -NGNST 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 33/76 (43%)
IGc2 55..125 CDD:197706 31/69 (45%)
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 34/79 (43%)
V-set 52..143 CDD:284989 36/90 (40%)
IG_like 153..238 CDD:214653 38/147 (26%)
ig 153..232 CDD:278476 35/141 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D60798at7147
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
87.970

Return to query results.
Submit another query.