DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and dpr14

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:355 Identity:91/355 - (25%)
Similarity:137/355 - (38%) Gaps:105/355 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSTFSDVG-----KITSSQNH-----FGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATV 72
            ||.|:|..     ::|.:..|     |.:    .:.|.|   :..|......|.|.|......||
  Fly    49 SSPFTDTPEDEELEVTETTTHEPFPFFAD----PYTTLN---ISTQLSSSVYLHCRVNDLQGKTV 106

  Fly    73 SWIRRK--DFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIV 135
            ||:||:  |..|:|.|..|:|.|.|:.:|. .....|.|.|:...|.|.|.||||:|.:|...::
  Fly   107 SWMRRRGDDLTLITFGQHTYSGDSRYSLEF-EEPNDWKLLIQFANERDEGPYECQVSSHPPLVLL 170

  Fly   136 IELKIVEAVAEI-----SSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYD-SQGGF 194
            :.|.|:....||     |:.||.:....||:.|:|.:.:.....:::.|.|..:::||| |:||.
  Fly   171 VYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGI 235

  Fly   195 VVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQH 259
            .|                                        .:|.:...|              
  Fly   236 SV----------------------------------------KTDMLPGRA-------------- 246

  Fly   260 QSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSILDTETNG 324
                     :|.|.:...|.:..|||||...|....::.||||.||:.|||||||.|    ....
  Fly   247 ---------LSRLYIANANRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHANGS----RQKA 298

  Fly   325 NGT------------FGLITLGGLNGTSGV 342
            |.:            .|.|::.|:|...|:
  Fly   299 NASTMVVLFLVYVCISGSISVAGMNRGLGL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 29/78 (37%)
IGc2 55..125 CDD:197706 26/71 (37%)
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 30/83 (36%)
Ig 84..169 CDD:299845 31/85 (36%)
IG_like 191..279 CDD:214653 27/150 (18%)
Ig 201..274 CDD:143165 22/135 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.