DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and rst

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:423 Identity:89/423 - (21%)
Similarity:141/423 - (33%) Gaps:120/423 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRK 78
            ||||::.   ||.:.||........:.....::.|.|:   |....|||.| :|...|:.| .:.
  Fly     7 LLLLATI---VGMVRSSPYTSYQNQRFAMEPQDQTAVV---GARVTLPCRV-INKQGTLQW-TKD 63

  Fly    79 DFQLLTVGLSTH---SSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIE--- 137
            ||     ||.|.   |..:|:.:..:...|.:||.|..|..:|...|:||:|..|.....|.   
  Fly    64 DF-----GLGTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTF 123

  Fly   138 ----LKIVEAVAEISSAPELHIDETSTLRLECKL---KRATENPAFVFWYH----------DSKM 185
                :.:.....:|:....::..|...:.:||..   |.|.|    :.|..          :..:
  Fly   124 AGLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVGGKPAAE----ITWIDGLGNVLTDNIEYTV 184

  Fly   186 INYDSQGGFVVTSIGQSNPQ---------------SGQFYRSSPANKSRATMPMESSNGVLNSLL 235
            |....|..|...|:.:..|:               :.:.|||:.........|....| |:.||.
  Fly   185 IPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKVN-VMGSLP 248

  Fly   236 GSSDAI--KAPAANVPSSTPYMTQQHQSAYL-----LNPS-----------------VSVLTVKQ 276
            |.:...  .|...:|..||.....:|....|     .|||                 .:.:.::.
  Fly   249 GGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIRN 313

  Fly   277 VNFR-HAGNYTC-------------------APS-NARPASITVHV-----LRGE-------KTA 308
            |..: |.....|                   ||| ..||.|:...|     |..|       :..
  Fly   314 VTRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIV 378

  Fly   309 AMQHANRSILDTETNGNGTFGLITLGGLNGTSG 341
            .:||.:..::.|.||       :|....|.|:|
  Fly   379 WIQHPSDRVVGTSTN-------LTFSVSNETAG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 25/79 (32%)
IGc2 55..125 CDD:197706 22/72 (31%)
rstNP_001284835.1 IG_like 34..130 CDD:214653 29/105 (28%)
Ig 42..114 CDD:299845 25/78 (32%)
C2-set_2 135..225 CDD:285423 13/93 (14%)
Ig_3 265..329 CDD:290638 10/63 (16%)
I-set 346..420 CDD:254352 17/66 (26%)
Ig 360..425 CDD:299845 11/52 (21%)
Ig5_KIRREL3-like 428..524 CDD:143235
IG_like 435..524 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.