DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and Kirrel1

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:185 Identity:43/185 - (23%)
Similarity:73/185 - (39%) Gaps:21/185 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEPKRWHLHL-SCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVV 64
            :..|.|..|| ..:|:.::...:    :..:|..|......|       .|:|  |..|:||||:
  Rat    25 LSQKMWAPHLVVAYLIFVTLALA----LPGTQTRFSQEPADQ-------TVVA--GHRAVLPCVL 76

  Fly    65 KVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIY 129
             :|....|.|  .||...|.:|... .:..|:.|..:...|.::|.|......|...||||.:..
  Rat    77 -LNYSGIVQW--TKDGLALGMGQGL-KAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEA 137

  Fly   130 PTQSIVIELKIV--EAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHD 182
            ..:|...:|.::  .....|...|.:.:...:...|.|:...| :..|.:.|:.|
  Rat   138 ALRSRRAKLTVLIPPEDTRIDGGPVILLQAGTPYNLTCRAFNA-KPAATIIWFRD 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 25/76 (33%)
IGc2 55..125 CDD:197706 21/69 (30%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 29/106 (27%)
Ig 57..148 CDD:299845 28/103 (27%)
Ig2_KIRREL3-like 170..251 CDD:143236 6/23 (26%)
I-set 255..336 CDD:254352
Ig_2 259..337 CDD:290606
Ig_2 340..437 CDD:290606
IG_like 346..437 CDD:214653
Ig5_KIRREL3 439..536 CDD:143306
IG_like 451..536 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.