DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and ncam1a

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_009293555.1 Gene:ncam1a / 30447 ZFINID:ZDB-GENE-990415-31 Length:1010 Species:Danio rerio


Alignment Length:318 Identity:69/318 - (21%)
Similarity:109/318 - (34%) Gaps:103/318 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHT 101
            ::::::...|.|..|.|...||   |........||.|.|         |.:...||:::.:...
Zfish   210 SIRTRYTELNATADINQAVTLA---CHADGYPEPTVKWAR---------GNTELESDEKYSLNED 262

  Fly   102 RHMGHWSLRIKAVREEDRGFYEC-------QLSIYPTQSIVIELKIVEAVAEISSAPELHIDETS 159
            ..    .|.||.|.:.|.|.|:|       :.|...|.::.::.||  ...|..:|.||  :|..
Zfish   263 GS----ELTIKDVNKLDEGDYKCIARNKAGERSEEVTLNVFVQPKI--TFLENQTASEL--EEQI 319

  Fly   160 TLRLECKLKRATENPA-FVFW-------------------YHDS------------------KMI 186
            ||..|     ||.:|. .:.|                   .|.|                  |.:
Zfish   320 TLTCE-----ATGDPTPNIIWSFGRRVFTENEQASWTRPEKHKSLDGNVVVRSDARVSSLTLKYV 379

  Fly   187 NYDSQGGFVVT---SIGQ---------------SNPQSGQFYRSSPANKSRATMPMESSNGVLNS 233
            .:...|.::.|   ||||               ..||:...:..:|||.:...:....:     |
Zfish   380 QFTDAGQYLCTARNSIGQDIQSMYLEVRYAPKIQGPQAVFTWEGNPANITCEALAHPGA-----S 439

  Fly   234 LLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSN 291
            :|...|..:.|:||..:...|.|          |:||.|.|...:....|:|.|..:|
Zfish   440 VLWFRDGQQLPSANTTNVKIYNT----------PTVSFLEVTPDSQNDFGSYNCTATN 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 20/83 (24%)
IGc2 55..125 CDD:197706 18/76 (24%)
ncam1aXP_009293555.1 Ig 20..112 CDD:299845
I-set 21..111 CDD:254352
IG_like 121..200 CDD:214653
IGc2 128..189 CDD:197706
Ig 208..301 CDD:299845 24/106 (23%)
IG_like 219..298 CDD:214653 24/94 (26%)
Ig 300..406 CDD:299845 23/114 (20%)
IG_like 308..406 CDD:214653 21/104 (20%)
ig 413..498 CDD:278476 22/90 (24%)
IG_like 415..498 CDD:214653 22/88 (25%)
fn3 505..589 CDD:278470
FN3 624..715 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.