DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr19 and Lsamp

DIOPT Version :9

Sequence 1:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus


Alignment Length:352 Identity:85/352 - (24%)
Similarity:147/352 - (41%) Gaps:62/352 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGH 106
            || :....:..::|..|||.|||: :..:.|:|:.|..  ::..|....|.|.|..:| .||...
  Rat    51 FN-RGTDNITVRQGDTAILRCVVE-DKNSKVAWLNRSG--IIFAGHDKWSLDPRVELE-KRHALE 110

  Fly   107 WSLRIKAVREEDRGFYECQLSIY---PTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLK 168
            :||||:.|...|.|.|.|.:...   .|..:.:.:::...::.|||  ::.::|.|.:.|.|...
  Rat   111 YSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISS--DVTVNEGSNVTLVCMAN 173

  Fly   169 RATENPAFVFWYHDSKM-INYDSQGGFVVTSIGQSNPQSGQFYRSSPANK-SRATMPM------- 224
            ...|  ..:.|.|.:.: ..::.:..: :..:|.:..|||: |....||: |.|.:..       
  Rat   174 GRPE--PVITWRHLTPLGREFEGEEEY-LEILGITREQSGK-YECKAANEVSSADVKQVKVTVNY 234

  Fly   225 ----------ESSNGVLNSLLGSSDAIKAP---------AANVPSSTPYMTQQHQSAYLLNPSVS 270
                      |::.|...||...:.|:.||         ..|..:.....:.:.||:        
  Rat   235 PPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSS-------- 291

  Fly   271 VLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSILDT---ETNGNGTFGLIT 332
             |||..|...|.|||||..:|....:....||.......:.|..:.|..|   :..|.|     :
  Rat   292 -LTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTVPHPIQEIGTTVHFKQKGPG-----S 350

  Fly   333 LGGLNGTSGVTLAGGI-LYFSGLFLLM 358
            :.|:||:  ::||..: |..:.||.|:
  Rat   351 VRGINGS--ISLAVPLWLLAASLFCLL 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 26/76 (34%)
IGc2 55..125 CDD:197706 25/69 (36%)
LsampXP_038944182.1 Ig 55..145 CDD:416386 27/93 (29%)
FR1 55..71 CDD:409353 4/15 (27%)
Ig strand A' 56..62 CDD:409353 0/5 (0%)
Ig strand B 64..72 CDD:409353 4/7 (57%)
CDR1 72..76 CDD:409353 1/4 (25%)
FR2 77..84 CDD:409353 2/6 (33%)
Ig strand C 77..83 CDD:409353 2/5 (40%)
CDR2 85..95 CDD:409353 1/11 (9%)
Ig strand C' 87..90 CDD:409353 0/2 (0%)
Ig strand C' 92..95 CDD:409353 0/2 (0%)
FR3 96..131 CDD:409353 15/35 (43%)
Ig strand D 100..107 CDD:409353 2/7 (29%)
Ig strand E 110..116 CDD:409353 3/5 (60%)
Ig strand F 123..131 CDD:409353 3/7 (43%)
CDR3 132..136 CDD:409353 0/3 (0%)
Ig strand G 136..145 CDD:409353 1/8 (13%)
FR4 138..145 CDD:409353 1/6 (17%)
Ig_3 148..218 CDD:404760 15/75 (20%)
Ig strand A' 155..160 CDD:409353 2/6 (33%)
Ig strand B 166..173 CDD:409353 2/6 (33%)
Ig strand C 179..184 CDD:409353 1/4 (25%)
Ig strand D 190..193 CDD:409353 0/2 (0%)
Ig strand E 197..203 CDD:409353 0/6 (0%)
Ig strand F 210..217 CDD:409353 2/7 (29%)
Ig strand G 224..232 CDD:409353 0/7 (0%)
Ig_3 235..311 CDD:404760 20/84 (24%)
Ig strand B 252..256 CDD:409353 2/3 (67%)
Ig strand C 265..269 CDD:409353 0/3 (0%)
Ig strand E 290..294 CDD:409353 2/12 (17%)
Ig strand F 304..309 CDD:409353 4/4 (100%)
Ig strand G 318..321 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.